Target Information

Target General Infomation
Target ID
T85670
Former ID
TTDI02219
Target Name
Beta-nerve growth factor
Gene Name
NGF
Synonyms
BetaNGF; NGF
Target Type
Clinical Trial
Disease Alzheimer disease [ICD9: 331; ICD10: G30]
Chronic pain [ICD9: 338.2,780; ICD10: R52.1-R52.2, G89]
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Function
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI (PubMed:20164177).
BioChemical Class
Growth factor
UniProt ID
P01138
Sequence
MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIA
ARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSK
RSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRR
A
Drugs and Mode of Action
Drug(s) SAR164877 Drug Info Phase 2/3 Pain [525196]
CERE-110 Drug Info Phase 2 Alzheimer disease [522629]
CXB-909 Drug Info Phase 1/2 Neurodegenerative disease [523752]
ABT-110 Drug Info Phase 1 Chronic pain [522730]
MEDI-578 Drug Info Phase 1 Pain [551134]
NsG-0202 Drug Info Phase 1 Alzheimer disease [523114]
Nerve growth factor Drug Info Terminated Alzheimer disease [544700]
Modulator ABT-110 Drug Info
CERE-110 Drug Info [530834]
CXB-909 Drug Info [1572591]
MEDI-578 Drug Info
Nerve growth factor Drug Info [556264]
NsG-0202 Drug Info [1572591]
SAR164877 Drug Info
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Pathway Interaction Database SHP2 signaling
p75(NTR)-mediated signaling
Neurotrophic factor-mediated Trk receptor signaling
Trk receptor signaling mediated by PI3K and PLC-gamma
Reactome Frs2-mediated activation
ARMS-mediated activation
NRAGE signals death through JNK
p75NTR negatively regulates cell cycle via SC1
PI3K/AKT activation
NADE modulates death signalling
NRIF signals cell death from the nucleus
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
Axonal growth stimulation
WikiPathways SIDS Susceptibility Pathways
MAPK Signaling Pathway
BDNF signaling pathway
Signalling by NGF
NGF signalling via TRKA from the plasma membrane
References
Ref 522629ClinicalTrials.gov (NCT00876863) Randomized, Controlled Study Evaluating CERE-110 in Subjects With Mild to Moderate Alzheimer's Disease. U.S. National Institutes of Health.
Ref 522730ClinicalTrials.gov (NCT00941746) Safety and Tolerability of PG110 in Patients With Knee Osteoarthritis Pain. U.S. National Institutes of Health.
Ref 523114ClinicalTrials.gov (NCT01163825) Encapsulated Cell Biodelivery of Nerve Growth Factor to Alzheimer?? Disease Patients. U.S. National Institutes of Health.
Ref 523752ClinicalTrials.gov (NCT01505907) Pharmacokinetic Study of CXB909 in Healthy Male Subjects. U.S. National Institutes of Health.
Ref 525196ClinicalTrials.gov (NCT02447276) Study of REGN475 in Patients With Pain Due to Osteoarthritis of the Knee or Hip. U.S. National Institutes of Health.
Ref 544700Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000658)
Ref 551134Clinical pipeline report, company report or official report of MedImmune (2011).
Ref
Ref 530834CERE-110, an adeno-associated virus-based gene delivery vector expressing human nerve growth factor for the treatment of Alzheimer's disease. Curr Opin Mol Ther. 2010 Apr;12(2):240-7.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.