Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T13644
|
||||
Former ID |
TTDC00254
|
||||
Target Name |
Somatostatin receptor type 3
|
||||
Gene Name |
SSTR3
|
||||
Synonyms |
SS3R; SSR-28; SSTR3
|
||||
Target Type |
Successful
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Cushing's disease [ICD9: 255; ICD10: E24.0] | |||||
Neuroendocrine cancer [ICD10: C7A] | |||||
Function |
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T13644
|
||||
UniProt ID | |||||
Sequence |
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL |
||||
Drugs and Mode of Action | |||||
Drug(s) | Pasireotide | Drug Info | Approved | Cushing's disease | [1], [2] |
ODT-8 | Drug Info | Phase 3 | Discovery agent | [3] | |
FR-121196 | Drug Info | Terminated | Alzheimer disease | [4] | |
Modulator | 99mTc-MIP-1407 | Drug Info | [5], [6] | ||
FR-121196 | Drug Info | [5], [6] | |||
Agonist | BN-81,644 | Drug Info | [7] | ||
BN-81,674 | Drug Info | [7] | |||
CGP 23996 | Drug Info | [8] | |||
L-796,778 | Drug Info | [9] | |||
SRIF-14 | Drug Info | [10] | |||
Inhibitor | CytotoxinPeptide Conjugate | Drug Info | [11] | ||
Des-AA1,2,4,12,13-[D-Trp8]SRIF | Drug Info | [12] | |||
Des-AA1,2,4,13-[D-Trp8]SRIF | Drug Info | [12] | |||
Des-AA1,2,4,5,10,12,13-[D-Trp8]SRIF | Drug Info | [12] | |||
Des-AA1,2,4,5,13-[D-Trp8]-SRIF | Drug Info | [12] | |||
Des-AA1,2,4,5-[D-Trp8]SRIF | Drug Info | [12] | |||
Des-AA1,2,5,12,13-[D-Trp8,IAmp9]SRIF | Drug Info | [12] | |||
Des-AA1,2,5,12,13-[D-Trp8]SRIF | Drug Info | [12] | |||
Des-AA1,2,5-[D-Trp8,(NalphaMe)IAmp9]SRIF | Drug Info | [13] | |||
Des-AA1,2,5-[D-Trp8,IAmp9,m-I-Tyr11]Cbm-SRIF | Drug Info | [13] | |||
Des-AA1,2,5-[D-Trp8,IAmp9]SRIF CH-275 | Drug Info | [13] | |||
Des-AA1,2,5-[D-Trp8,Tyr11]SRIF | Drug Info | [13] | |||
Des-AA1,4,5,13-[Tyr2,D-Trp8]-SRIF | Drug Info | [12] | |||
Des-AA1,5-[Tyr2,D-Trp8,IAmp9]Cbm-SRIF | Drug Info | [13] | |||
Des-AA5-[D-Trp8]SRIF | Drug Info | [13] | |||
H-D-Phe-c[Cys-Ala-D-Trp-Lys-Thr-Cys]-Thr-NH2 | Drug Info | [14] | |||
H-DPhe-c[Cys-Phe-DTrp-Lys-Thr-Cys]-Thr-NH2 | Drug Info | [14] | |||
ODT-8 | Drug Info | [12] | |||
Pasireotide | Drug Info | [15] | |||
Radiolabeled octreotide derivative | Drug Info | [16] | |||
SOMATOSTATIN | Drug Info | [17] | |||
SRIF-28 | Drug Info | [18] | |||
Antagonist | NVP ACQ090 | Drug Info | [15] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Reactome | Peptide ligand-binding receptors | ||||
G alpha (i) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Peptide GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
REF 1 | ClinicalTrials.gov (NCT02527993) Treatment of Hypoglycemia Following Gastric Bypass Surgery. | ||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 3 | ClinicalTrials.gov (NCT01220167) Three-way Crossover Comparative Water-effect Bioavailability to Compare Ondansetron ODFS 8mg With and Without Water With Zofran ODT 8mg Without Water in 18 Healthy Participants Under Fasting Conditions. U.S. National Institutes of Health. | ||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001380) | ||||
REF 5 | Mol Endocrinol. 2010 Feb;24(2):436-46. Epub 2010 Jan 5.Pasireotide and octreotide stimulate distinct patterns of sst2A somatostatin receptor phosphorylation. | ||||
REF 6 | Nat Rev Drug Discov. 2013 Feb;12(2):87-90. | ||||
REF 7 | Identification of potent non-peptide somatostatin antagonists with sst(3) selectivity. J Med Chem. 2001 Aug 30;44(18):2990-3000. | ||||
REF 8 | Characterisation of human recombinant somatostatin receptors. 1. Radioligand binding studies. Naunyn Schmiedebergs Arch Pharmacol. 1999 Nov;360(5):488-99. | ||||
REF 9 | Rapid identification of subtype-selective agonists of the somatostatin receptor through combinatorial chemistry. Science. 1998 Oct 23;282(5389):737-40. | ||||
REF 10 | A human somatostatin receptor (SSTR3), located on chromosome 22, displays preferential affinity for somatostatin-14 like peptides. FEBS Lett. 1993 Apr 26;321(2-3):279-84. | ||||
REF 11 | Bioorg Med Chem Lett. 2003 Mar 10;13(5):799-803.An adjustable release rate linking strategy for cytotoxin-peptide conjugates. | ||||
REF 12 | J Med Chem. 2005 Jan 27;48(2):515-22.Somatostatin receptor 1 selective analogues: 3. Dicyclic peptides. | ||||
REF 13 | J Med Chem. 2005 Jan 27;48(2):507-14.Somatostatin receptor 1 selective analogues: 2. N(alpha)-Methylated scan. | ||||
REF 14 | J Med Chem. 2006 Jul 27;49(15):4487-96.Novel sst2-selective somatostatin agonists. Three-dimensional consensus structure by NMR. | ||||
REF 15 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 357). | ||||
REF 16 | J Med Chem. 2005 Apr 21;48(8):2778-89.N-terminal sugar conjugation and C-terminal Thr-for-Thr(ol) exchange in radioiodinated Tyr3-octreotide: effect on cellular ligand trafficking in vitro and tumor accumulation in vivo. | ||||
REF 17 | J Med Chem. 2005 Oct 20;48(21):6643-52.Discovery of iodinated somatostatin analogues selective for hsst2 and hsst5 with excellent inhibition of growth hormone and prolactin release from rat pituitarycells. | ||||
REF 18 | J Med Chem. 2010 Aug 26;53(16):6188-97.Novel octreotide dicarba-analogues with high affinity and different selectivity for somatostatin receptors. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.