Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T22995
|
||||
Former ID |
TTDI02090
|
||||
Target Name |
Hepcidin
|
||||
Gene Name |
HAMP
|
||||
Synonyms |
Hepc20; Hepc25; Hepcidin20; LEAP1; Liverexpressed antimicrobial peptide 1; PLTR; Putative liver tumor regressor; HAMP
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Anemia [ICD9: 280-285; ICD10: D50-D64] | ||||
Function |
Has strong antimicrobial activity against E.coli ML35P N.cinereaand weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa (PubMed:11113131, PubMed:11034317).
|
||||
BioChemical Class |
Hepcidin family
|
||||
UniProt ID | |||||
Sequence |
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
WikiPathways | Iron metabolism in placenta | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.