Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T28998
|
||||
Former ID |
TTDS00253
|
||||
Target Name |
Gonadotropin-releasing hormone
|
||||
Gene Name |
GNRH1
|
||||
Synonyms |
GnRH; Gonadoliberin; LH-RH; LHRH; Leutinizing-hormone-releasing hormone; Luliberin; GNRH1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Prostate cancer [ICD9: 185; ICD10: C61] | ||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
|
||||
BioChemical Class |
Hormone
|
||||
Target Validation |
T28998
|
||||
UniProt ID | |||||
Sequence |
MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQR
FECTTHQPRSPLRDLKGALESLIEEETGQKKI |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | GnRH signaling pathway | ||||
Pathway Interaction Database | Nongenotropic Androgen signaling | ||||
Reactome | Hormone ligand-binding receptors | ||||
G alpha (q) signalling events | |||||
WikiPathways | Gastrin-CREB signalling pathway via PKC and MAPK | ||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 535483 | In vivo properties of an anti-GnRH Spiegelmer: an example of an oligonucleotide-based therapeutic substance class. Proc Natl Acad Sci U S A. 2002 Jun 25;99(13):8898-902. Epub 2002 Jun 17. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.