Target General Infomation
Target ID
T32335
Former ID
TTDC00222
Target Name
Inhibitor of nuclear factor kappa-B kinase
Gene Name
IKBKE
Synonyms
I kappa B kinase; IKK; IkBK; IKBKE
Target Type
Research
Disease Arthritis [ICD9: 710-719; ICD10: M00-M25]
Multiple myeloma [ICD9: 203; ICD10: C90]
Function
Serine kinase that plays an essential role in the NF- kappa-B signaling pathway which is activated by multiple stimuli such as inflammatory cytokines, bacterial or viral products, DNA damages or other cellular stresses. Acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. In addition to the NF-kappa-B inhibitors, phosphorylates several other components of the signaling pathway including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. IKK-related kinase phosphorylations may prevent the overproduction of inflammatory mediators sincethey exert a negative regulation on canonical IKKs. Also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation.
BioChemical Class
Kinase
Target Validation
T32335
UniProt ID
EC Number
EC 2.7.11.10
Sequence
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
Structure
3BRT; 3BRV; 4E3C; 4KIK
Inhibitor 4-hydroxy-2-nonenal Drug Info [535178]
5-Bromo-6-methoxy-9H-beta-carboline Drug Info [526654]
Arsenite Drug Info [535043]
BMS-345541 Drug Info [535797]
compound 17d Drug Info [532095]
MLN-120B Drug Info [528076]
MRT67307 Drug Info [531284]
PS-1145 Drug Info [537114]
S1627 Drug Info [535912]
TPCA-1 Drug Info [527173]
Pathways
PathWhiz Pathway Intracellular Signalling Through Adenosine Receptor A2a and Adenosine
Intracellular Signalling Through Adenosine Receptor A2b and Adenosine
Reactome Activation of NF-kappaB in B cells
NOD1/2 Signaling Pathway
RIP-mediated NFkB activation via ZBP1
AKT phosphorylates targets in the cytosol
p75NTR recruits signalling complexes
NF-kB is activated and signals survival
FCERI mediated NF-kB activation
Interleukin-1 signaling
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
IKBKB deficiency causes SCID
IKBKG deficiency causes anhidrotic ectodermal dysplasia with immunodeficiency (EDA-ID) (via TLR)
IkBA variant leads to EDA-ID
Dectin-1 mediated noncanonical NF-kB signaling
CLEC7A (Dectin-1) signaling
Constitutive Signaling by AKT1 E17K in Cancer
NIK--&gt
noncanonical NF-kB signaling
MAP3K8 (TPL2)-dependent MAPK1/3 activation
TRAF6 mediated IRF7 activation
TRAF6 mediated NF-kB activation
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
Negative regulators of RIG-I/MDA5 signaling
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
IRAK1 recruits IKK complex
IKK complex recruitment mediated by RIP1
IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
WikiPathways Toll-like receptor signaling pathway
Estrogen signaling pathway
TCR Signaling Pathway
Insulin Signaling
IL-4 Signaling Pathway
MAPK Signaling Pathway
NLR Proteins
Induction (Part 1 of 3)
MyD88 cascade initiated on plasma membrane
Cardiac Hypertrophic Response
Cytosolic sensors of pathogen-associated DNA
MyD88 dependent cascade initiated on endosome
Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways
Mal cascade initiated on plasma membrane
Fc epsilon receptor (FCERI) signaling
MyD88-independent cascade
Signaling by the B Cell Receptor (BCR)
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Structural Pathway of Interleukin 1 (IL-1)
EBV LMP1 signaling
Polycystic Kidney Disease Pathway
Apoptosis
Quercetin and Nf-kB/ AP-1 Induced Cell Apoptosis
BDNF signaling pathway
Interleukin-11 Signaling Pathway
AGE/RAGE pathway
TNF alpha Signaling Pathway
B Cell Receptor Signaling Pathway
IL17 signaling pathway
TWEAK Signaling Pathway
Leptin signaling pathway
RANKL/RANK Signaling Pathway
Signalling by NGF
IL-1 signaling pathway
TCR signaling
RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways
Interleukin-1 signaling
Apoptosis Modulation and Signaling
Type II diabetes mellitus
MicroRNAs in cardiomyocyte hypertrophy
Regulation of toll-like receptor signaling pathway
Osteopontin Signaling
NOD pathway
References
Ref 526654Bioorg Med Chem Lett. 2003 Jul 21;13(14):2419-22.Novel IKK inhibitors: beta-carbolines.
Ref 527173Attenuation of murine collagen-induced arthritis by a novel, potent, selective small molecule inhibitor of IkappaB Kinase 2, TPCA-1 (2-[(aminocarbonyl)amino]-5-(4-fluorophenyl)-3-thiophenecarboxamide), occurs via reduction of proinflammatory cytokines and antigen-induced T cell Proliferation. J Pharmacol Exp Ther. 2005 Jan;312(1):373-81. Epub 2004 Aug 17.
Ref 528076A selective small molecule IkappaB Kinase beta inhibitor blocks nuclear factor kappaB-mediated inflammatory responses in human fibroblast-like synoviocytes, chondrocytes, and mast cells. J Pharmacol Exp Ther. 2006 Jun;317(3):989-1001. Epub 2006 Mar 8.
Ref 531284Novel cross-talk within the IKK family controls innate immunity. Biochem J. 2011 Feb 15;434(1):93-104.
Ref 532095Synthesis and structure-activity relationships of a novel series of pyrimidines as potent inhibitors of TBK1/IKKepsilon kinases. Bioorg Med Chem Lett. 2012 Dec 1;22(23):7169-73.
Ref 535043Inhibition of NF-kappa B activation by arsenite through reaction with a critical cysteine in the activation loop of Ikappa B kinase. J Biol Chem. 2000 Nov 17;275(46):36062-6.
Ref 535178IkappaB kinase, a molecular target for inhibition by 4-hydroxy-2-nonenal. J Biol Chem. 2001 May 25;276(21):18223-8. Epub 2001 Mar 16.
Ref 535797A highly selective inhibitor of I kappa B kinase, BMS-345541, blocks both joint inflammation and destruction in collagen-induced arthritis in mice. Arthritis Rheum. 2003 Sep;48(9):2652-9.
Ref 535912Specific Inhibition of IkappaB kinase reduces hyperalgesia in inflammatory and neuropathic pain models in rats. J Neurosci. 2004 Feb 18;24(7):1637-45.
Ref 537114Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.