Target General Infomation
Target ID
T35173
Former ID
TTDI02026
Target Name
Inhibitor of apoptosis protein 1
Gene Name
BIRC3
Synonyms
API2; Apoptosis inhibitor 2; Baculoviral IAP repeatcontaining protein3; CIAP2; IAP homolog C; IAP1; RING finger protein 49; TNFR2TRAFsignaling complex protein 1; hIAP1; BIRC3
Target Type
Clinical Trial
Disease Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86]
Function
Multi-functional protein which regulatesnot only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin- protein ligase regulating NF-kappa-B signaling and regulates both canonical and non-canonical NF-kappa-B signaling by acting in opposite directions: acts as a positive regulator of the canonical pathway and suppresses constitutive activation of non-canonical NF-kappa-B signaling. The target proteins for its E3 ubiquitin- protein ligase activity include: RIPK1, RIPK2, RIPK3, RIPK4, CASP3, CASP7, CASP8, IKBKE, TRAF1, and BCL10. Acts as an important regulator of innate immune signaling via regulation of Toll-like receptors (TLRs), Nodlike receptors (NLRs) and RIG-I like receptors (RLRs), collectively referred to as pattern recognition receptors (PRRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase- independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8.
BioChemical Class
Carbon-nitrogen ligase
UniProt ID
EC Number
EC 6.3.2.-
Sequence
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
Drugs and Mode of Action
Drug(s) Debio 1143 Drug Info Phase 1/2 Lymphoma [524580]
Antagonist AZD5582 Drug Info [532581]
Inhibitor Debio 1143 Drug Info [533079], [544451]
Pathways
KEGG Pathway NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
NOD-like receptor signaling pathway
TNF signaling pathway
Toxoplasmosis
Pathways in cancer
Transcriptional misregulation in cancer
Small cell lung cancer
NetPath Pathway IL5 Signaling Pathway
IL1 Signaling Pathway
IL2 Signaling Pathway
TNFalpha Signaling Pathway
Notch Signaling Pathway
TCR Signaling Pathway
PANTHER Pathway Apoptosis signaling pathway
CCKR signaling map ST
Pathway Interaction Database CD40/CD40L signaling
FAS (CD95) signaling pathway
TNF receptor signaling pathway
Ceramide signaling pathway
p75(NTR)-mediated signaling
C-MYB transcription factor network
Negative effector of Fas and TNF-alpha
Caspase Cascade in Apoptosis
Reactome NOD1/2 Signaling Pathway
RIPK1-mediated regulated necrosis
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
TNFR2 non-canonical NF-kB pathway
Regulation of necroptotic cell death
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
IKK complex recruitment mediated by RIP1
WikiPathways Focal Adhesion
Apoptosis
TNF alpha Signaling Pathway
TWEAK Signaling Pathway
Apoptosis Modulation and Signaling
References
Ref 524580ClinicalTrials.gov (NCT02022098) Debio 1143-201 Dose-finding and Efficacy Phase I/II Trial. U.S. National Institutes of Health.
Ref 532581Discovery of a novel class of dimeric Smac mimetics as potent IAP antagonists resulting in a clinical candidate for the treatment of cancer (AZD5582). J Med Chem. 2013 Dec 27;56(24):9897-919.
Ref 533079Debio 1143, an antagonist of multiple inhibitor-of-apoptosis proteins, activates apoptosis and enhances radiosensitization of non-small cell lung cancer cells in vitro. Am J Cancer Res. 2014 Nov 19;4(6):943-51. eCollection 2014.
Ref 544451Debio 1143, an antagonist of multiple inhibitor-of-apoptosis proteins, activates apoptosis and enhances radiosensitization of non-small cell lung cancer cells in vitro. Am J Cancer Res. 2014; 4(6): 943-951.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.