Target General Infomation
Target ID
T38431
Former ID
TTDR00790
Target Name
Calgranulin B
Gene Name
S100A9
Synonyms
Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; MRP-14; MRP14; Migration inhibitory factor-related protein 14; Myeloid-related protein 14; P14; S100 calcium-binding protein A9; S100A9
Target Type
Clinical Trial
Disease Lupus [ICD9: 710; ICD10: M32]
Metastatic prostate cancer [ICD9: 185; ICD10: C61]
Function
S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH- oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF- kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective rolein preventing exaggerated tissue damage by scavenging oxidants. Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread.
BioChemical Class
S-100 family
UniProt ID
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Drugs and Mode of Action
Drug(s) Tasquinimod Drug Info Phase 3 Metastatic prostate cancer [523240], [542970]
Paquinimod Drug Info Phase 2 Lupus [523718]
Inhibitor Paquinimod Drug Info [533239]
Modulator Tasquinimod Drug Info [544360]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
Pathway Interaction Database Endogenous TLR signaling
WikiPathways Vitamin D Receptor Pathway
IL1 and megakaryotyces in obesity
References
Ref 523240ClinicalTrials.gov (NCT01234311) A Study of Tasquinimod in Men With Metastatic Castrate Resistant Prostate Cancer. U.S. National Institutes of Health.
Ref 523718ClinicalTrials.gov (NCT01487551) An Open-Label Study to Evaluate Biomarkers and Safety in Systemic Sclerosis Patients Treated With ABR-215757 (Paquinimod). U.S. National Institutes of Health.
Ref 542970(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8098).
Ref 533239Prophylactic treatment with S100A9 inhibitor paquinimod reduces pathology in experimental collagenase-induced osteoarthritis. Ann Rheum Dis. 2015 May 12. pii: annrheumdis-2014-206517.
Ref 544360Mechanisms of action of tasquinimod on the tumour microenvironment. Cancer Chemother Pharmacol. 2014; 73(1): 1-8.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.