Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T49630
|
||||
Former ID |
TTDR00861
|
||||
Target Name |
Lectin-like oxidized ldl receptor
|
||||
Gene Name |
OLR1
|
||||
Synonyms |
LOX-1; LOX1; Lectin-like oxidized LDL receptor-1; Lectin-like oxidized low-density lipoprotein receptor-1; Lectin-type oxidized LDL receptor; Oxidised low density lipoprotein (Lectin-like) receptor 1; Oxidized low-density lipoprotein receptor; OLR1
|
||||
Target Type |
Discontinued
|
||||
Disease | Arteriosclerosis [ICD9: 440; ICD10: I70] | ||||
Function |
Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro- oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro- atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram- positive bacteria.
|
||||
BioChemical Class |
Transmembrane protein
|
||||
UniProt ID | |||||
Sequence |
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ MELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLL KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.