Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T51499
|
||||
Former ID |
TTDI02169
|
||||
Target Name |
Ganglioside GM2 activator
|
||||
Gene Name |
GM2A
|
||||
Synonyms |
Cerebroside sulfate activator protein; GM2AP; Ganglioside GM2 activator isoform short; SAP3; Sphingolipid activator protein 3; GM2A
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Multiple myeloma [ICD9: 203; ICD10: C90] | ||||
Function |
The large binding pocket can accommodate severalsingle chain phospholipids and fatty acids, GM2A also exhibits some calcium-independent phospholipase activity (By similarity). Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta- hexosaminidase A forcleavage of N-acetyl-D-galactosamine and conversion to GM3.
|
||||
UniProt ID | |||||
Sequence |
MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIV
PGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIP TGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKR LGCIKIAASLKGI |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.