Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T63595
|
||||
Former ID |
TTDR00518
|
||||
Target Name |
High mobility group protein 1
|
||||
Gene Name |
HMGB1
|
||||
Synonyms |
HMG-1; High mobility group box chromosomal protein 1; HMGB1
|
||||
Target Type |
Research
|
||||
Function |
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells (By similarity).
|
||||
BioChemical Class |
High mobility group box
|
||||
UniProt ID | |||||
Sequence |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
||||
Pathways | |||||
KEGG Pathway | Base excision repair | ||||
NetPath Pathway | TSH Signaling Pathway | ||||
TCR Signaling Pathway | |||||
PANTHER Pathway | p53 pathway | ||||
Pathway Interaction Database | Beta3 integrin cell surface interactions | ||||
amb2 Integrin signaling | |||||
Endogenous TLR signaling | |||||
Reactome | RIP-mediated NFkB activation via ZBP1 | ||||
Activation of DNA fragmentation factor | |||||
DEx/H-box helicases activate type I IFN and inflammatory cytokines production | |||||
TAK1 activates NFkB by phosphorylation and activation of IKKs complex | |||||
Advanced glycosylation endproduct receptor signaling | |||||
TRAF6 mediated NF-kB activation | |||||
WikiPathways | DNA Damage Response (only ATM dependent) | ||||
Cytosolic sensors of pathogen-associated DNA | |||||
TAK1 activates NFkB by phosphorylation and activation of IKKs complex | |||||
Retinoblastoma (RB) in Cancer | |||||
RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways | |||||
Apoptotic execution phase | |||||
Advanced glycosylation endproduct receptor signaling | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.