Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T66976
|
||||
Former ID |
TTDS00060
|
||||
Target Name |
Alcohol dehydrogenase
|
||||
Gene Name |
AKR1A1
|
||||
Synonyms |
Aldehyde reductase; Aldo-keto reductase family 1 member A1; AKR1A1
|
||||
Target Type |
Research
|
||||
Function |
Catalyzes the NADPH-dependent reductionof a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. In vitro substrates include succinic semialdehyde, 4- nitrobenzaldehyde, 1,2-naphthoquinone, methylglyoxal, and D- glucuronic acid. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs, including the anthracyclines doxorubicin (DOX) and daunorubicin (DAUN).
|
||||
BioChemical Class |
Short-chain dehydrogenases reductases
|
||||
Target Validation |
T66976
|
||||
UniProt ID | |||||
EC Number |
EC 1.1.1.2
|
||||
Sequence |
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV PMLTVDGKRVPRDAGHPLYPFNDPY |
||||
Inhibitor | 2'-Monophosphoadenosine 5'-Diphosphoribose | Drug Info | [1] | ||
3,5-dichlorosalicylic acid | Drug Info | [2] | |||
Nicotinamide-Adenine-Dinucleotide | Drug Info | [1] | |||
Trifluoroethanol | Drug Info | [3] | |||
Pathways | |||||
BioCyc Pathway | Superpathway of tryptophan utilization | ||||
Tryptophan degradation via tryptamine | |||||
KEGG Pathway | Glycolysis / Gluconeogenesis | ||||
Pentose and glucuronate interconversions | |||||
Glycerolipid metabolism | |||||
Metabolic pathways | |||||
Biosynthesis of antibiotics | |||||
Degradation of aromatic compounds | |||||
WikiPathways | Metapathway biotransformation | ||||
Benzo(a)pyrene metabolism | |||||
References | |||||
REF 1 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 2 | Bioorg Med Chem. 2009 Feb 1;17(3):1244-50. Epub 2008 Dec 24.Correlation of binding constants and molecular modelling of inhibitors in the active sites of aldose reductase and aldehyde reductase. | ||||
REF 3 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.