Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T88452
|
||||
| Former ID |
TTDS00068
|
||||
| Target Name |
Corticosteroid-binding globulin
|
||||
| Gene Name |
SERPINA6
|
||||
| Synonyms |
CBG; Transcortin; SERPINA6
|
||||
| Target Type |
Successful
|
||||
| Disease | Asthma; Obstructive airway diseases [ICD9:490-492, 494-496; ICD10: J45, J40-J44, J47] | ||||
| Diabetic macular edema [ICD9: 250, 362.01, 362.07, 362.53, 782.3; ICD10: E08-E13, E08.3, E09.3, E10.3, E11.3, E13.3, H35.8, R60.9] | |||||
| Diabetic retinopathy [ICD9: 250.5; ICD10: H36, E10.3, E11.3, E13.3] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Function |
Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
|
||||
| BioChemical Class |
Serpin family
|
||||
| Target Validation |
T88452
|
||||
| UniProt ID | |||||
| Sequence |
MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPK
KNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSD TSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQG KIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTI SYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLY IPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDT AGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Alclometasone | Drug Info | Approved | Inflammatory disease | [1] |
| Ciclesonide | Drug Info | Approved | Asthma; Obstructive airway diseases | [2], [3], [4], [5] | |
| Paramethasone | Drug Info | Approved | Inflammatory disease | [6] | |
| Paramethasone | Drug Info | Phase 3 | Diabetic macular edema | [5] | |
| I-vation | Drug Info | Phase 2 | Diabetic retinopathy | [7] | |
| Binder | Alclometasone | Drug Info | [8] | ||
| Ciclesonide | Drug Info | [9], [10] | |||
| Paramethasone | Drug Info | [9], [10] | |||
| Modulator | I-vation | Drug Info | [11] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| REF 1 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| REF 2 | 2006 drug approvals: finding the niche. Nat Rev Drug Discov. 2007 Feb;6(2):99-101. | ||||
| REF 3 | Emerging drugs for asthma. Expert Opin Emerg Drugs. 2008 Dec;13(4):643-53. | ||||
| REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7469). | ||||
| REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
| REF 6 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012772. | ||||
| REF 7 | Drug delivery implants in the treatment of vitreous inflammation. Mediators Inflamm. 2013;2013:780634. | ||||
| REF 8 | The anti-inflammatory effects of LY178002 and LY256548. Agents Actions. 1989 Jun;27(3-4):300-2. | ||||
| REF 9 | Novel human corticosteroid-binding globulin variant with low cortisol-binding affinity. J Clin Endocrinol Metab. 2000 Jan;85(1):361-7. | ||||
| REF 10 | A Leu----His substitution at residue 93 in human corticosteroid binding globulin results in reduced affinity for cortisol. J Steroid Biochem Mol Biol. 1992 Aug;42(7):671-6. | ||||
| REF 11 | Cortisol binding in rat skeletal muscle. J Biol Chem. 1975 Feb 25;250(4):1207-11. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.