Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T08813
|
||||
Former ID |
TTDR00977
|
||||
Target Name |
CAMP-dependent protein kinase type I-alpha regulatory chain
|
||||
Gene Name |
PRKAR1A
|
||||
Synonyms |
CAMP-dependent protein kinase (PKA); PKA RIalpha-subunit; RIalpha subunit of cAMP-dependent protein kinase; TSE1; Tissue-specific extinguisher-1; PRKAR1A
|
||||
Target Type |
Research
|
||||
Function |
Regulatorysubunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells.
|
||||
BioChemical Class |
Kinase
|
||||
Target Validation |
T08813
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.1.37
|
||||
Sequence |
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG PCSDILKRNIQQYNSFVSLSV |
||||
Inhibitor | 5-(2-methylpiperazin-1-ylsulfonyl)isoquinoline | Drug Info | [1] | ||
AdcAhxArg4Lys(biotin)-PEG-OMe | Drug Info | [2] | |||
AdcAhxArg4Lys-PEGOMe | Drug Info | [2] | |||
AdcAhxArg4NH(CH2)6NH2 | Drug Info | [2] | |||
AdcAhxArg6 | Drug Info | [2] | |||
AdoC(Ahx)Arg6 | Drug Info | [3] | |||
AdoC(Aoc)Arg6 | Drug Info | [3] | |||
AdoC(Aun)Arg6 | Drug Info | [3] | |||
AdoC(beta-Ala)2AlaArg6 | Drug Info | [3] | |||
AdoC(beta-Ala)Arg6 | Drug Info | [3] | |||
AdoC(betaAsp)2AlaArg6 | Drug Info | [3] | |||
AdoC(Dpr)2AlaArg6 | Drug Info | [3] | |||
AdoC(GABA)Arg6 | Drug Info | [3] | |||
AdoCGlyArg6 | Drug Info | [3] | |||
Cyclic Adenosine Monophosphate | Drug Info | [4] | |||
Cyclic Guanosine Monophosphate | Drug Info | [4] | |||
RO-316233 | Drug Info | [5] | |||
Sp-Adenosine-3',5'-Cyclic-Monophosphorothioate | Drug Info | [4] | |||
Pathways | |||||
KEGG Pathway | Apoptosis | ||||
Insulin signaling pathway | |||||
NetPath Pathway | FSH Signaling Pathway | ||||
PANTHER Pathway | Endothelin signaling pathway | ||||
Hedgehog signaling pathway | |||||
Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
Metabotropic glutamate receptor group III pathway | |||||
Metabotropic glutamate receptor group II pathway | |||||
Metabotropic glutamate receptor group I pathway | |||||
Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
Transcription regulation by bZIP transcription factor | |||||
GABA-B receptor II signaling | |||||
Pathway Interaction Database | Alpha4 beta1 integrin signaling events | ||||
PathWhiz Pathway | Muscle/Heart Contraction | ||||
Reactome | PKA activation | ||||
PKA activation in glucagon signalling | |||||
DARPP-32 events | |||||
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion | |||||
Vasopressin regulates renal water homeostasis via Aquaporins | |||||
Hedgehog ' | |||||
off' | |||||
state | |||||
Factors involved in megakaryocyte development and platelet production | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
Calcium Regulation in the Cardiac Cell | |||||
G Protein Signaling Pathways | |||||
Myometrial Relaxation and Contraction Pathways | |||||
Mesodermal Commitment Pathway | |||||
DAG and IP3 signaling | |||||
Regulation of Water Balance by Renal Aquaporins | |||||
miRs in Muscle Cell Differentiation | |||||
Opioid Signalling | |||||
Integration of energy metabolism | |||||
Factors involved in megakaryocyte development and platelet production | |||||
References | |||||
REF 1 | J Biol Chem. 1996 Oct 18;271(42):26157-64.Crystal structures of catalytic subunit of cAMP-dependent protein kinase in complex with isoquinolinesulfonyl protein kinase inhibitors H7, H8, and H89. Structural implications for selectivity. | ||||
REF 2 | Bioorg Med Chem Lett. 2003 Sep 15;13(18):3035-9.Liquid-phase synthesis of a pegylated adenosine-oligoarginine conjugate, cell-permeable inhibitor of cAMP-dependent protein kinase. | ||||
REF 3 | Bioorg Med Chem Lett. 1999 May 17;9(10):1447-52.Adenosine-5'-carboxylic acid peptidyl derivatives as inhibitors of protein kinases. | ||||
REF 4 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 5 | J Med Chem. 1992 Jan;35(1):177-84.Inhibitors of protein kinase C. 1. 2,3-Bisarylmaleimides. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.