Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T19923
|
||||
Former ID |
TTDR01405
|
||||
Target Name |
mRNA of Bcl-x
|
||||
Gene Name |
BCL2L1
|
||||
Synonyms |
Apoptosis regulator BclX (mRNA); BCL2L1 (mRNA); Bcl2L1 (mRNA); Bcl2like protein 1 (mRNA); BCL2L1
|
||||
Target Type |
Discontinued
|
||||
Function |
Isoform Bcl-X(S) promotes apoptosis.
|
||||
BioChemical Class |
Bcl-2 family
|
||||
Target Validation |
T19923
|
||||
UniProt ID | |||||
Sequence |
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Ras signaling pathway | ||||
NF-kappa B signaling pathway | |||||
PI3K-Akt signaling pathway | |||||
Apoptosis | |||||
Jak-STAT signaling pathway | |||||
Amyotrophic lateral sclerosis (ALS) | |||||
Toxoplasmosis | |||||
HTLV-I infection | |||||
Pathways in cancer | |||||
Transcriptional misregulation in cancer | |||||
Pancreatic cancer | |||||
Chronic myeloid leukemia | |||||
Small cell lung cancer | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
TGF_beta_Receptor Signaling Pathway | |||||
Notch Signaling Pathway | |||||
PANTHER Pathway | Apoptosis signaling pathway | ||||
CCKR signaling map ST | |||||
Pathway Interaction Database | IL2 signaling events mediated by PI3K | ||||
IL3-mediated signaling events | |||||
Caspase Cascade in Apoptosis | |||||
EPO signaling pathway | |||||
IL2 signaling events mediated by STAT5 | |||||
Reactome | BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members | ||||
The NLRP1 inflammasome | |||||
WikiPathways | IL-6 signaling pathway | ||||
IL-3 Signaling Pathway | |||||
Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways | |||||
Apoptosis | |||||
Amyotrophic lateral sclerosis (ALS) | |||||
TNF alpha Signaling Pathway | |||||
IL-7 Signaling Pathway | |||||
Leptin signaling pathway | |||||
Intrinsic Pathway for Apoptosis | |||||
Apoptosis Modulation and Signaling | |||||
References | |||||
Ref 526790 | J Med Chem. 2003 Sep 25;46(20):4259-64.Discovery, characterization, and structure-activity relationships studies of proapoptotic polyphenols targeting B-cell lymphocyte/leukemia-2 proteins. | ||||
Ref 528469 | J Med Chem. 2006 Oct 19;49(21):6139-42.Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.