Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T27186
|
||||
Former ID |
TTDC00176
|
||||
Target Name |
Placenta growth factor
|
||||
Gene Name |
PGF
|
||||
Synonyms |
PlGF-131; PGF
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Macular degeneration [ICD9: 362.5; ICD10: H35.3] | ||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Growth factor active in angiogenesisand endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth.
|
||||
BioChemical Class |
Growth factor
|
||||
Target Validation |
T27186
|
||||
UniProt ID | |||||
Sequence |
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL TFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWP SSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
KEGG Pathway | Ras signaling pathway | ||||
Rap1 signaling pathway | |||||
PI3K-Akt signaling pathway | |||||
Focal adhesion | |||||
Pathways in cancer | |||||
NetPath Pathway | TSH Signaling Pathway | ||||
Pathway Interaction Database | VEGFR1 specific signals | ||||
Reactome | VEGF ligand-receptor interactions | ||||
VEGF binds to VEGFR leading to receptor dimerization | |||||
WikiPathways | Focal Adhesion | ||||
Signaling by VEGF | |||||
References | |||||
Ref 522356 | ClinicalTrials.gov (NCT00702494) Phase I Study on Monoclonal Antibody TB-403 Directed Against PlGF in Patients With Solid Tumours. U.S. National Institutes of Health. | ||||
Ref 531341 | sFLT01: a novel fusion protein with antiangiogenic activity. Mol Cancer Ther. 2011 Mar;10(3):404-15. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.