Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T34743
|
||||
Former ID |
TTDS00213
|
||||
Target Name |
DNA
|
||||
Gene Name |
dacA
|
||||
Synonyms |
Penicillin binding protein; dacA
|
||||
Target Type |
Successful
|
||||
Disease | Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | ||||
Acute myeloid leukemia [ICD9: 205; ICD10: C92.0] | |||||
Arthritis [ICD9: 710-719; ICD10: M00-M25] | |||||
Acute bronchitis [ICD10: J20-J21, J42] | |||||
Brain cancer; Glioma [ICD9:191, 225.0; ICD10: C71, D33] | |||||
Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33] | |||||
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
Cystic fibrosis [ICD9: 277; ICD10: E84] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Chronic lymphocytic leukaemia [ICD10: C91] | |||||
Chronic bronchitis [ICD10: J42] | |||||
Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | |||||
Fungal infections [ICD9: 110-118; ICD10: B35-B49] | |||||
Gram-positive bacterial infection [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104] | |||||
Gastrointestinal cancers; Breast cancers [ICD9: 150-159, 174, 175; ICD10: C15-C26, C50] | |||||
Hodgkin's lymphoma [ICD10: C81] | |||||
Herpes simplex virus infection [ICD9: 54; ICD10: B00] | |||||
Infections of the upper and lower urinary tract [ICD10: A00-B99] | |||||
Infections by susceptible microorganisms [ICD10: A00-B99] | |||||
Leukemia [ICD9: 208.9; ICD10: C90-C95] | |||||
Lupus nephritis [ICD9: 583.81; ICD10: M32.1, N08.5] | |||||
Malaria [ICD10: B54] | |||||
Myelodysplastic syndrome; Acute lymphoblastic leukemia [ICD9:238.7, 204.0, 556; ICD10: D46, C91.0] | |||||
Metastatic islet cell carcinoma [ICD9: 157.4; ICD10: C25.4] | |||||
Melanoma [ICD9: 172; ICD10: C43] | |||||
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
Psoriasis; Cutaneous T-cell lymphoma [ICD9:696, 202.1, 202.2; ICD10: L40, C84.0, C84.1] | |||||
Pseudomonas aeruginosa infection; Haemophilus influenzae infection [ICD10: B96.5] | |||||
Refractory chronic myeloid leukaemia [ICD9: 205.1; ICD10: C92.1] | |||||
Systemic lupus erythematosus [ICD9: 710; ICD10: M32] | |||||
Sepsis [ICD9: 995.91; ICD10: A40, A41] | |||||
Stage IA/IB mycosisfungoides-type cutaneous T-cell lymphoma [ICD10: C81-C86] | |||||
Urinary tract infections [ICD9: 599; ICD10: N39.0] | |||||
Target Validation |
T34743
|
||||
UniProt ID | |||||
Sequence |
MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQIDAESYILIDYNSGKVL
AEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDAWATGNPVFKGSSLMFL KPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKNTHFQTVH GLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGIRQLNRNGLLWDNSLNVDG IKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAESKKLLTWGFRFFETVNPLKV GKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKASYVLNSSELHAPLQKNQVVGT INFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFHHWFG |
||||
Drugs and Mode of Action | |||||
Drug(s) | Adenine | Drug Info | Approved | Dietary shortage | [1], [2] |
Altretamine | Drug Info | Approved | Ovarian cancer | [3], [4] | |
Ampicillin | Drug Info | Approved | Bacterial infections | [5] | |
Azlocillin | Drug Info | Approved | Pseudomonas aeruginosa infection; Haemophilus influenzae infection | [6] | |
Bacampicillin | Drug Info | Approved | Bacterial infections | [7] | |
Balofloxacin | Drug Info | Approved | Gram-positive bacterial infection | [8] | |
Bleomycin | Drug Info | Approved | Hodgkin's lymphoma | [9] | |
Carbenicillin | Drug Info | Approved | Infections of the upper and lower urinary tract | [6] | |
Cefacetrile | Drug Info | Approved | Bacterial infections | [10] | |
Cefaclor | Drug Info | Approved | Bacterial infections | [11] | |
Cefadroxil | Drug Info | Approved | Bacterial infections | [12], [13] | |
Cefamandole | Drug Info | Approved | Infections by susceptible microorganisms | [6] | |
Cefazolin | Drug Info | Approved | Bacterial infections | [14] | |
Cefdinir | Drug Info | Approved | Bacterial infections | [15] | |
Cefditoren | Drug Info | Approved | Bacterial infections | [9] | |
Cefixime | Drug Info | Approved | Bacterial infections | [9] | |
Cefonicid | Drug Info | Approved | Bacterial infections | [9] | |
Cefoperazone | Drug Info | Approved | Bacterial infections | [9] | |
Ceforanide | Drug Info | Approved | Bacterial infections | [9] | |
Cefotetan | Drug Info | Approved | Bacterial infections | [9] | |
Cefoxitin | Drug Info | Approved | Bacterial infections | [9] | |
Cefpiramide | Drug Info | Approved | Bacterial infections | [9] | |
Cefpodoxime | Drug Info | Approved | Bacterial infections | [9] | |
Cefprozil | Drug Info | Approved | Bacterial infections | [9] | |
Cefradine | Drug Info | Approved | Bacterial infections | [16], [17] | |
Ceftazidime | Drug Info | Approved | Bacterial infections | [9] | |
Ceftibuten | Drug Info | Approved | Chronic bronchitis | [6] | |
Ceftizoxime | Drug Info | Approved | Bacterial infections | [9] | |
Cefuroxime | Drug Info | Approved | Acute bronchitis | [6] | |
Cephalexin | Drug Info | Approved | Bacterial infections | [18], [19] | |
Cephapirin | Drug Info | Approved | Sepsis | [20], [6] | |
Chlorambucil | Drug Info | Approved | Chronic lymphocytic leukaemia | [21], [22] | |
Ciprofloxacin XR | Drug Info | Approved | Gram-positive bacterial infection | [8] | |
Clofarabine | Drug Info | Approved | Myelodysplastic syndrome; Acute lymphoblastic leukemia | [23], [9], [24], [6] | |
Cloxacillin | Drug Info | Approved | Bacterial infections | [25] | |
Cyclacillin | Drug Info | Approved | Bacterial infections | [26], [27], [6] | |
Dacarbazine | Drug Info | Approved | Melanoma | [28] | |
Dactinomycin | Drug Info | Approved | Cancer | [29] | |
Dicloxacillin | Drug Info | Approved | Bacterial infections | [30] | |
Dornase Alfa | Drug Info | Approved | Cystic fibrosis | [9] | |
Elliptinium acetate | Drug Info | Approved | Cancer | [6] | |
Ertapenem | Drug Info | Approved | Bacterial infections | [9] | |
Flucloxacillin | Drug Info | Approved | Bacterial infections | [31] | |
Idoxuridine | Drug Info | Approved | Herpes simplex virus infection | [32] | |
Lomustine | Drug Info | Approved | Brain cancer; Glioma | [33], [34], [6] | |
Loracarbef | Drug Info | Approved | Bacterial infections | [9] | |
Mechlorethamine | Drug Info | Approved | Stage IA/IB mycosisfungoides-type cutaneous T-cell lymphoma | [6] | |
Mercaptopurine | Drug Info | Approved | Acute lymphoblastic leukemia | [35], [36] | |
Methoxsalen | Drug Info | Approved | Psoriasis; Cutaneous T-cell lymphoma | [37], [6] | |
Methylene blue | Drug Info | Approved | Acquired methemoglobinemia | [38] | |
Meticillin | Drug Info | Approved | Bacterial infections | [39] | |
Mitomycin | Drug Info | Approved | Gastrointestinal cancers; Breast cancers | [9], [40] | |
Mitomycin A | Drug Info | Approved | Cancer | [9] | |
Mitomycin C | Drug Info | Approved | Cancer | [9] | |
Nafcillin | Drug Info | Approved | Arthritis | [41], [6] | |
Nelarabine | Drug Info | Approved | Leukemia | [9], [42], [43], [44] | |
Neocarzinostatin | Drug Info | Approved | Cancer | [6] | |
Nitrofurantoin | Drug Info | Approved | Urinary tract infections | [45] | |
Oxacillin | Drug Info | Approved | Bacterial infections | [46] | |
Penicillin V | Drug Info | Approved | Bacterial infections | [47] | |
Piperacillin | Drug Info | Approved | Bacterial infections | [48] | |
Pipobroman | Drug Info | Approved | Refractory chronic myeloid leukaemia | [49], [50], [6] | |
Pirarubicin | Drug Info | Approved | Breast cancer | [51], [6] | |
Pivampicillin | Drug Info | Approved | Bacterial infections | [52] | |
Pivmecillinam | Drug Info | Approved | Urinary tract infections | [53], [6] | |
Primaquine | Drug Info | Approved | Malaria | [54] | |
Procarbazine | Drug Info | Approved | Hodgkin's lymphoma | [55], [56] | |
Proflavine | Drug Info | Approved | Sepsis | [57] | |
Streptozocin | Drug Info | Approved | Metastatic islet cell carcinoma | [9] | |
Thioguanine | Drug Info | Approved | Acute myeloid leukemia | [9], [58] | |
Ticarcillin | Drug Info | Approved | Bacterial infections | [59] | |
Uracil mustard | Drug Info | Approved | Acute myeloid leukemia | [9], [60], [6] | |
Zinostatin stimalamer | Drug Info | Approved | Brain cancer | [6] | |
Mechlorethamine | Drug Info | Phase 3 | Hodgkin's lymphoma | [61], [6] | |
Indol-3-carbinol | Drug Info | Preclinical | Fungal infections | [62] | |
Abetimus sodium | Drug Info | Discontinued in Phase 3 | Lupus nephritis | [63] | |
TV-4710 | Drug Info | Discontinued in Phase 2 | Systemic lupus erythematosus | [63] | |
Talisomycin | Drug Info | Terminated | Discovery agent | [64] | |
Meticillin | Drug Info | Investigative | Neurological disease | [65] | |
Inhibitor | 2-(3,4-Dihydroxyphenyl)Acetic Acid | Drug Info | [66] | ||
Abetimus sodium | Drug Info | [63] | |||
Balofloxacin | Drug Info | [8] | |||
Beta-D-Glucose | Drug Info | [66] | |||
Ciprofloxacin XR | Drug Info | [8] | |||
Lipid Fragment | Drug Info | [66] | |||
Lomustine | Drug Info | [67] | |||
Phosphomethylphosphonic Acid Adenosyl Ester | Drug Info | [66] | |||
Thiamin Diphosphate | Drug Info | [66] | |||
TV-4710 | Drug Info | [63] | |||
Intercalator | Actinomycin D | Drug Info | [68] | ||
Adriamycin | Drug Info | [69] | |||
Ametantrone | Drug Info | [70] | |||
Chlorambucil | Drug Info | [71] | |||
Daunomycin | Drug Info | [72] | |||
Ethidium | Drug Info | [72] | |||
Mechlorethamine | Drug Info | [73] | |||
Nogalamycin | Drug Info | [74] | |||
Thioguanine | Drug Info | [75] | |||
Binder | Adenine | Drug Info | [76], [77] | ||
Ampicillin | Drug Info | [78] | |||
Azlocillin | Drug Info | [79] | |||
Bacampicillin | Drug Info | [80] | |||
Carbenicillin | Drug Info | [81] | |||
Cefacetrile | Drug Info | [82] | |||
Cefaclor | Drug Info | [83] | |||
Cefadroxil | Drug Info | [84] | |||
Cefamandole | Drug Info | [85] | |||
Cefazolin | Drug Info | [86] | |||
Cefdinir | Drug Info | [87] | |||
Cefditoren | Drug Info | [88] | |||
Cefixime | Drug Info | [89] | |||
Cefonicid | Drug Info | [90] | |||
Cefoperazone | Drug Info | [91] | |||
Ceforanide | Drug Info | [92] | |||
Cefotetan | Drug Info | [93] | |||
Cefoxitin | Drug Info | [94] | |||
Cefpiramide | Drug Info | [80] | |||
Cefpodoxime | Drug Info | [95] | |||
Cefprozil | Drug Info | [96] | |||
Cefradine | Drug Info | [94] | |||
Ceftazidime | Drug Info | [97] | |||
Ceftibuten | Drug Info | [98] | |||
Ceftizoxime | Drug Info | [99] | |||
Cefuroxime | Drug Info | [100] | |||
Cephalexin | Drug Info | [101] | |||
Cephapirin | Drug Info | [102] | |||
Clofarabine | Drug Info | [103] | |||
Cloxacillin | Drug Info | [104] | |||
Cyclacillin | Drug Info | [80] | |||
Dicloxacillin | Drug Info | [105] | |||
Ertapenem | Drug Info | [99] | |||
Flucloxacillin | Drug Info | [105] | |||
Idoxuridine | Drug Info | [106] | |||
Indol-3-carbinol | Drug Info | [62] | |||
Loracarbef | Drug Info | [95] | |||
Methoxsalen | Drug Info | [107] | |||
Meticillin | Drug Info | [108] | |||
Mitomycin | Drug Info | [109] | |||
Nafcillin | Drug Info | [110] | |||
Nelarabine | Drug Info | [42] | |||
Oxacillin | Drug Info | [111] | |||
Penicillin V | Drug Info | [112] | |||
Piperacillin | Drug Info | [113] | |||
Pipobroman | Drug Info | [114] | |||
Pivampicillin | Drug Info | [80] | |||
Pivmecillinam | Drug Info | [115] | |||
Proflavine | Drug Info | [116] | |||
Ticarcillin | Drug Info | [117] | |||
Breaker | Altretamine | Drug Info | [118] | ||
Bleomycin | Drug Info | [119] | |||
Dacarbazine | Drug Info | [120] | |||
Dactinomycin | Drug Info | [121] | |||
Dornase Alfa | Drug Info | [122] | |||
Duocarmycin | Drug Info | [121] | |||
Enediyne antibiotics | Drug Info | [121] | |||
Mercaptopurine | Drug Info | [123] | |||
Nitracrine | Drug Info | [124] | |||
Nitrofurantoin | Drug Info | [125] | |||
Streptozocin | Drug Info | [126] | |||
Talisomycin | Drug Info | [119] | |||
Binder (minor groove binder) | Bisbenzimide (Hoechst 33258) | Drug Info | [127] | ||
Di-imidazole lexitropsin | Drug Info | [128] | |||
Distamycin A | Drug Info | [129] | |||
Netropsin | Drug Info | [130] | |||
Modulator | Elliptinium acetate | Drug Info | [131], [132], [9] | ||
Neocarzinostatin | Drug Info | [9] | |||
Pirarubicin | Drug Info | [9] | |||
Uracil mustard | Drug Info | [133] | |||
Zinostatin stimalamer | Drug Info | [9] | |||
References | |||||
REF 1 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4788). | ||||
REF 2 | Drug information of Adenine, 2008. eduDrugs. | ||||
REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019926. | ||||
REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7112). | ||||
REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061936. | ||||
REF 6 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 7 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050520. | ||||
REF 8 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
REF 9 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
REF 10 | Drug information of Cefacetrile, 2008. eduDrugs. | ||||
REF 11 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062206. | ||||
REF 12 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4831). | ||||
REF 13 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062291. | ||||
REF 14 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 065244. | ||||
REF 15 | Emerging therapies for the treatment and prevention of otitis media. Expert Opin Emerg Drugs. 2006 May;11(2):251-64. | ||||
REF 16 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4830). | ||||
REF 17 | Textbook of Therapeutics: Drug and Disease Management. 2006, P892. By Richard A. Helms, Eric T. Herfindal, David J. Quan, Dick R. Gourley. | ||||
REF 18 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4832). | ||||
REF 19 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061969. | ||||
REF 20 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062720. | ||||
REF 21 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010669. | ||||
REF 22 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7143). | ||||
REF 23 | 2004 approvals: the demise of the blockbuster. Nat Rev Drug Discov. 2005 Feb;4(2):93-4. | ||||
REF 24 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6802). | ||||
REF 25 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061454. | ||||
REF 26 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4817). | ||||
REF 27 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062895. | ||||
REF 28 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075259. | ||||
REF 29 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050682. | ||||
REF 30 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062286. | ||||
REF 31 | Drug information of Flucloxacillin, 2008. eduDrugs. | ||||
REF 32 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 014169. | ||||
REF 33 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 017588. | ||||
REF 34 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7214). | ||||
REF 35 | S-adenosylmethionine regulates thiopurine methyltransferase activity and decreases 6-mercaptopurine cytotoxicity in MOLT lymphoblasts. Biochem Pharmacol. 2009 Jun 15;77(12):1845-53. Epub 2009 Mar 19. | ||||
REF 36 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7226). | ||||
REF 37 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009048. | ||||
REF 38 | Recombinant Plasmodium falciparum glutathione reductase is inhibited by the antimalarial dye methylene blue. FEBS Lett. 1998 Feb 6;422(3):311-4. | ||||
REF 39 | Drug information of Meticillin, 2008. eduDrugs. | ||||
REF 40 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7089). | ||||
REF 41 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 062527. | ||||
REF 42 | Nelarabine. Drugs. 2008;68(4):439-47. | ||||
REF 43 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7090). | ||||
REF 44 | 2005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006). | ||||
REF 45 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009175. | ||||
REF 46 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 061490. | ||||
REF 47 | How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. | ||||
REF 48 | Zosyn (piperacillin/tazobactam) reformulation: Expanded compatibility and coadministration with lactated Ringer's solutions and selected aminoglycosides. Ther Clin Risk Manag. 2008 Apr;4(2):303-14. | ||||
REF 49 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016245. | ||||
REF 50 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7271). | ||||
REF 51 | ClinicalTrials.gov (NCT01746992) CTOP/ITE/MTX Compared With CHOP as the First-line Therapy for Newly Diagnosed Young Patients With T Cell Lymphoma. U.S. National Institutes of Health. | ||||
REF 52 | Drug information of Pivampicillin, 2008. eduDrugs. | ||||
REF 53 | Drug information of Pivmecillinam, 2008. eduDrugs. | ||||
REF 54 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 008316. | ||||
REF 55 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016785. | ||||
REF 56 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7278). | ||||
REF 57 | Drug information of Proflavine, 2008. eduDrugs. | ||||
REF 58 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6845). | ||||
REF 59 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050497. | ||||
REF 60 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7621). | ||||
REF 61 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7218). | ||||
REF 62 | Novel antifungal agents, targets or therapeutic strategies for the treatment of invasive fungal diseases: a review of the literature (2005-2009). Rev Iberoam Micol. 2009 Mar 31;26(1):15-22. Epub 2009 May 7. | ||||
REF 63 | Emergence of targeted immune therapies for systemic lupus. Expert Opin Emerg Drugs. 2005 Feb;10(1):53-65. | ||||
REF 64 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000802) | ||||
REF 65 | Alpha-conotoxins. Int J Biochem Cell Biol. 2000 Oct;32(10):1017-28. | ||||
REF 66 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 67 | Synthesis and evaluation of ethylnitrosoureas of substituted naphthalimides as anticancer compounds. Acta Pol Pharm. 2007 Jan-Feb;64(1):27-33. | ||||
REF 68 | Crystallographic analysis of a novel complex of actinomycin D bound to the DNA decamer CGATCGATCG. Biochemistry. 2001 May 15;40(19):5587-92. | ||||
REF 69 | Interaction of adriamycin with DNA as studied by resonance Raman spectroscopy. Nucleic Acids Res. 1982 Jun 25;10(12):3803-16. | ||||
REF 70 | Interactions of antitumor agents Ametantrone and Mitoxantrone (Novatrone) with double-stranded DNA. Biochem Pharmacol. 1985 Dec 15;34(24):4203-13. | ||||
REF 71 | Roles of DNA repair and reductase activity in the cytotoxicity of the hypoxia-activated dinitrobenzamide mustard PR-104A. Mol Cancer Ther. 2009 Jun;8(6):1714-23. Epub 2009 Jun 9. | ||||
REF 72 | 31P NMR spectra of ethidium, quinacrine, and daunomycin complexes with poly(adenylic acid).poly(uridylic acid) RNA duplex and calf thymus DNA. Biochemistry. 1989 Apr 4;28(7):2804-12. | ||||
REF 73 | Proteomic analysis of DNA-protein cross-linking by antitumor nitrogen mustards. Chem Res Toxicol. 2009 Jun;22(6):1151-62. | ||||
REF 74 | Structure, dynamics and hydration of the nogalamycin-d(ATGCAT)2Complex determined by NMR and molecular dynamics simulations in solution. J Mol Biol. 1999 Jul 16;290(3):699-716. | ||||
REF 75 | Immune effector cells produce lethal DNA damage in cells treated with a thiopurine. Cancer Res. 2009 Mar 15;69(6):2393-9. Epub 2009 Feb 24. | ||||
REF 76 | Leishmania donovani singly deficient in HGPRT, APRT or XPRT are viable in vitro and within mammalian macrophages. Mol Biochem Parasitol. 2006 Jul;148(1):24-30. Epub 2006 Mar 15. | ||||
REF 77 | E.coli DNA Adenine Methyltransferase: Intra-Site Processivity and Substrate-Induced Dimerization and Activation. Biochemistry. 2009 Jul 6. | ||||
REF 78 | Effects of amino acid alterations in penicillin-binding proteins (PBPs) 1a, 2b, and 2x on PBP affinities of penicillin, ampicillin, amoxicillin, cefditoren, cefuroxime, cefprozil, and cefaclor in 18 clinical isolates of penicillin-susceptible, -intermediate, and -resistant pneumococci. Antimicrob Agents Chemother. 2002 May;46(5):1273-80. | ||||
REF 79 | Reactivation of peptidoglycan synthesis in ether-permeabilized Escherichia coli after inhibition by beta-lactam antibiotics. Antimicrob Agents Chemother. 1989 Dec;33(12):2101-8. | ||||
REF 80 | Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. | ||||
REF 81 | Resistance of Pseudomonas aeruginosa to cefsulodin: modification of penicillin-binding protein 3 and mapping of its chromosomal gene. J Antimicrob Chemother. 1990 Apr;25(4):513-23. | ||||
REF 82 | Single dose 1 g ceftriaxone for urogenital and pharyngeal infection caused by Neisseria gonorrhoeae. Int J Urol. 2008 Sep;15(9):837-42. Epub 2008 Jul 25. | ||||
REF 83 | Antibacterial activity of oral cephems against various clinically isolated strains and evaluation of efficacy based on the pharmacokinetics/pharmacodynamics theory. Jpn J Antibiot. 2004 Dec;57(6):465-74. | ||||
REF 84 | Penicillin-binding protein sensitive to cephalexin in sporulation of Bacillus cereus. Microbiol Res. 1997 Sep;152(3):227-32. | ||||
REF 85 | The impact of penicillinase on cefamandole treatment and prophylaxis of experimental endocarditis due to methicillin-resistant Staphylococcus aureus. J Infect Dis. 1998 Jan;177(1):146-54. | ||||
REF 86 | Bacteriological characteristics of Staphylococcus aureus isolates from humans and bulk milk. J Dairy Sci. 2008 Feb;91(2):564-9. | ||||
REF 87 | Decreased affinity of mosaic-structure recombinant penicillin-binding protein 2 for oral cephalosporins in Neisseria gonorrhoeae. J Antimicrob Chemother. 2007 Jul;60(1):54-60. Epub 2007 May 31. | ||||
REF 88 | Crystal structure of cefditoren complexed with Streptococcus pneumoniae penicillin-binding protein 2X: structural basis for its high antimicrobial activity. Antimicrob Agents Chemother. 2007 Nov;51(11):3902-7. Epub 2007 Aug 27. | ||||
REF 89 | Genetics of chromosomally mediated intermediate resistance to ceftriaxone and cefixime in Neisseria gonorrhoeae. Antimicrob Agents Chemother. 2009 Jun 15. | ||||
REF 90 | Affinity of cefonicid, a long-acting cephalosporin, for the penicillin-binding proteins of Escherichia coli K-12. J Antibiot (Tokyo). 1984 May;37(5):572-6. | ||||
REF 91 | Clinical relevance of antibiotic-induced endotoxin release in patients undergoing hepatic resection. World J Surg. 1999 Jan;23(1):75-9. | ||||
REF 92 | The pharmacokinetics of the interstitial space in humans. BMC Clin Pharmacol. 2003 Jul 30;3:3. | ||||
REF 93 | In-vitro profile of a new beta-lactam, ceftobiprole, with activity against methicillin-resistant Staphylococcus aureus. Clin Microbiol Infect. 2007 Jun;13 Suppl 2:17-24. | ||||
REF 94 | Staphylococcus aureus PBP4 is essential for beta-lactam resistance in community-acquired methicillin-resistant strains. Antimicrob Agents Chemother. 2008 Nov;52(11):3955-66. Epub 2008 Aug 25. | ||||
REF 95 | Amino acid substitutions in mosaic penicillin-binding protein 2 associated with reduced susceptibility to cefixime in clinical isolates of Neisseria gonorrhoeae. Antimicrob Agents Chemother. 2006 Nov;50(11):3638-45. Epub 2006 Aug 28. | ||||
REF 96 | Microbiology and antimicrobial management of sinusitis. J Laryngol Otol. 2005 Apr;119(4):251-8. | ||||
REF 97 | New and emerging treatment of Staphylococcus aureus infections in the hospital setting. Clin Microbiol Infect. 2008 Apr;14 Suppl 3:32-41. | ||||
REF 98 | Neisseria gonorrhoeae and emerging resistance to extended spectrum cephalosporins. Curr Opin Infect Dis. 2009 Feb;22(1):87-91. | ||||
REF 99 | Role of penicillin-binding protein 2 (PBP2) in the antibiotic susceptibility and cell wall cross-linking of Staphylococcus aureus: evidence for the cooperative functioning of PBP2, PBP4, and PBP2A. JBacteriol. 2005 Mar;187(5):1815-24. | ||||
REF 100 | Cefuroxime resistance in non-beta-lactamase Haemophilus influenzae is linked to mutations in ftsI. J Antimicrob Chemother. 2003 Mar;51(3):523-30. | ||||
REF 101 | Relationship between penicillin-binding protein patterns and beta-lactamases in clinical isolates of Bacteroides fragilis with different susceptibility to beta-lactam antibiotics. J Med Microbiol. 2004 Mar;53(Pt 3):213-21. | ||||
REF 102 | The formation of functional penicillin-binding proteins. J Biol Chem. 1975 Aug 25;250(16):6578-85. | ||||
REF 103 | Clofarabine: past, present, and future. Leuk Lymphoma. 2007 Oct;48(10):1922-30. | ||||
REF 104 | Development of a receptor-based microplate assay for the detection of beta-lactam antibiotics in different food matrices. Anal Chim Acta. 2007 Mar 14;586(1-2):296-303. Epub 2006 Sep 26. | ||||
REF 105 | Mechanisms of resistance to beta-lactam antibiotics in Staphylococcus aureus. Scand J Infect Dis Suppl. 1984;42:64-71. | ||||
REF 106 | Radiopharmaceuticals (Strontium 89) and radiosensitizers (idoxuridine). J Intraven Nurs. 1998 Nov-Dec;21(6):335-7. | ||||
REF 107 | Mutagenicity and carcinogenicity of methoxsalen plus UV-A. Arch Dermatol. 1984 May;120(5):662-9. | ||||
REF 108 | A link in transcription between the native pbpB and the acquired mecA gene in a strain of Staphylococcus aureus. Microbiology. 2006 Sep;152(Pt 9):2549-58. | ||||
REF 109 | Assessment of cell viability, lipid peroxidation and quantification of DNA fragmentation after the treatment of anticancerous drug mitomycin C and curcumin in cultured human blood lymphocytes. Exp Toxicol Pathol. 2009 Jul 14. | ||||
REF 110 | Binding affinity for penicillin-binding protein 2a correlates with in vivo activity of beta-lactam antibiotics against methicillin-resistant Staphylococcus aureus. J Infect Dis. 1990 Sep;162(3):705-10. | ||||
REF 111 | Novel anion liposome-encapsulated antisense oligonucleotide restores susceptibility of methicillin-resistant Staphylococcus aureus and rescues mice from lethal sepsis by targeting mecA. Antimicrob Agents Chemother. 2009 Jul;53(7):2871-8. Epub 2009 May 11. | ||||
REF 112 | Localization of penicillin-binding proteins to the splitting system of Staphylococcus aureus septa by using a mercury-penicillin V derivative. J Bacteriol. 1995 Jul;177(13):3631-40. | ||||
REF 113 | In vitro antienterococcal activity explains associations between exposures to antimicrobial agents and risk of colonization by multiresistant enterococci. J Infect Dis. 2004 Dec 15;190(12):2162-6. Epub 2004 Nov 16. | ||||
REF 114 | Effects of piposulfan (Ancyte) on protein and DNA synthesis in Ehrlich ascites carcinoma. Life Sci II. 1971 Jun 8;10(11):605-12. | ||||
REF 115 | Association between antimicrobial consumption and resistance in Escherichia coli. Antimicrob Agents Chemother. 2009 Mar;53(3):912-7. Epub 2008 Dec 22. | ||||
REF 116 | Interaction of small molecules with double-stranded RNA: spectroscopic, viscometric, and calorimetric study of hoechst and proflavine binding to PolyCG structures. DNA Cell Biol. 2009 Apr;28(4):209-19. | ||||
REF 117 | Activities of antibiotics against methicillin-resistant Staphylococcus aureus with particular reference to synergetic effect between ticarcillin and fosfomycin on penicillinase non-producing methicillin-resistant S. aureus. Jpn J Antibiot. 1993 Jun;46(6):421-7. | ||||
REF 118 | Synergy of irofulven in combination with other DNA damaging agents: synergistic interaction with altretamine, alkylating, and platinum-derived agents in the MV522 lung tumor model. Cancer Chemother Pharmacol. 2008 Dec;63(1):19-26. Epub 2008 Feb 28. | ||||
REF 119 | Bleomycin and talisomycin sequence-specific strand scission of DNA: a mechanism of double-strand cleavage. Cancer Res. 1982 Jul;42(7):2779-85. | ||||
REF 120 | Predicting the myelotoxicity of chemotherapy: the use of pretreatment O6-methylguanine-DNA methyltransferase determination in peripheral blood mononuclear cells. Melanoma Res. 2009 Jun 25. | ||||
REF 121 | Structural studies of atom-specific anticancer drugs acting on DNA. Pharmacol Ther. 1999 Sep;83(3):181-215. | ||||
REF 122 | Dornase alfa. BioDrugs. 1997 Dec;8(6):439-45. | ||||
REF 123 | 6-mercaptopurine (6-MP) induces p53-mediated apoptosis of neural progenitor cells in the developing fetal rodent brain. Neurotoxicol Teratol. 2009 Jul-Aug;31(4):198-202. Epub 2009 Mar 10. | ||||
REF 124 | Crosslinking of cellular DNA by nitracrine and furocoumarin derivatives. Neoplasma. 1999;46(1):50-3. | ||||
REF 125 | On the nature of the adaptive response induced by mitomycin C in Vibrio cholerae OGAWA 154 cells. Biochem Biophys Res Commun. 1996 Mar 27;220(3):509-14. | ||||
REF 126 | Hydrodynamics-based Transfection of Pancreatic Duodenal Homeobox 1 DNA Improves Hyperglycemia and is Associated with Limited Complications in Diabetic mice. Endocr J. 2009 Jun 27. | ||||
REF 127 | Sequence-dependent effects in drug-DNA interaction: the crystal structure of Hoechst 33258 bound to the d(CGCAAATTTGCG)2 duplex. Nucleic Acids Res. 1994 May 11;22(9):1607-12. | ||||
REF 128 | Defining GC-specificity in the minor groove: side-by-side binding of the di-imidazole lexitropsin to C-A-T-G-G-C-C-A-T-G. Structure. 1997 Aug 15;5(8):1033-46. | ||||
REF 129 | Development of distamycin-related DNA binding anticancer drugs. Expert Opin Investig Drugs. 2001 Sep;10(9):1703-14. | ||||
REF 130 | Drug-DNA binding specificity: binding of netropsin and distamycin to poly(d2NH2A-dT). Biopolymers. 1990;30(1-2):223-7. | ||||
REF 131 | Plants as a source of anti-cancer agents. J Ethnopharmacol. 2005 Aug 22;100(1-2):72-9. | ||||
REF 132 | Stationary potential of the brain: Part II. Clinical studies. Neurol Med Chir (Tokyo). 1979 Jul;19(7):655-64. | ||||
REF 133 | Excision of DNA adducts of nitrogen mustards by bacterial and mammalian 3-methyladenine-DNA glycosylases. Carcinogenesis. 1996 Apr;17(4):643-8. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.