Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T44282
|
||||
| Former ID |
TTDR01185
|
||||
| Target Name |
Aldehyde dehydrogenase, mitochondrial
|
||||
| Gene Name |
ALDH2
|
||||
| Synonyms |
ALDH class 2; ALDH-E2; ALDHI; Aldehyde dehydrogenase; Humanliver mitochondrial aldehyde dehydrogenase; Mitochondrial aldehyde dehydrogenase; ALDH2
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Alcohol use disorders [ICD9: 303; ICD10: F10.2] | ||||
| Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | |||||
| Substance dependence [ICD10: F10-F19] | |||||
| BioChemical Class |
Oxidoreductases acting on aldehyde or oxo group of donors
|
||||
| Target Validation |
T44282
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.2.1.3
|
||||
| Sequence |
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | ALD-401 | Drug Info | Phase 2 | Cerebrovascular ischaemia | [1] |
| GS-6637 | Drug Info | Phase 1 | Substance dependence | [2] | |
| Daidzin | Drug Info | Terminated | Discovery agent | [3] | |
| Modulator | ALD-401 | Drug Info | [4] | ||
| Inhibitor | Crotonaldehyde | Drug Info | [5] | ||
| Daidzin | Drug Info | [5] | |||
| GS-6637 | Drug Info | [6], [7] | |||
| ISOFORMONENTIN | Drug Info | [8] | |||
| Nicotinamide-Adenine-Dinucleotide | Drug Info | [5] | |||
| prunetin | Drug Info | [8] | |||
| Antagonist | CVT-10216 | Drug Info | [9] | ||
| Pathways | |||||
| KEGG Pathway | Glycolysis / Gluconeogenesis | ||||
| Pentose and glucuronate interconversions | |||||
| Ascorbate and aldarate metabolism | |||||
| Fatty acid degradation | |||||
| Valine, leucine and isoleucine degradation | |||||
| Lysine degradation | |||||
| Arginine and proline metabolism | |||||
| Histidine metabolism | |||||
| Tryptophan metabolism | |||||
| beta-Alanine metabolism | |||||
| Glycerolipid metabolism | |||||
| Pyruvate metabolism | |||||
| Metabolic pathways | |||||
| Biosynthesis of antibiotics | |||||
| PathWhiz Pathway | Beta-Alanine Metabolism | ||||
| Ethanol Degradation | |||||
| Histidine Metabolism | |||||
| Valine, Leucine and Isoleucine Degradation | |||||
| Pyruvate Metabolism | |||||
| Oxidation of Branched Chain Fatty Acids | |||||
| Glycine and Serine Metabolism | |||||
| Tryptophan Metabolism | |||||
| WikiPathways | Tryptophan metabolism | ||||
| Fatty Acid Omega Oxidation | |||||
| Phase 1 - Functionalization of compounds | |||||
| Neurotransmitter Clearance In The Synaptic Cleft | |||||
| References | |||||
| REF 1 | ClinicalTrials.gov (NCT01273337) Study of ALD-401 Via Intracarotid Infusion in Ischemic Stroke Subjects. U.S. National Institutes of Health. | ||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040688) | ||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007965) | ||||
| REF 4 | A novel aldehyde dehydrogenase-3 activator leads to adult salivary stem cell enrichment in vivo. Clin Cancer Res. 2011 Dec 1;17(23):7265-72. | ||||
| REF 5 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 6 | Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36. | ||||
| REF 7 | Clinical pipeline report, company report or official report of Gilead. | ||||
| REF 8 | J Med Chem. 2008 Aug 14;51(15):4482-7. Epub 2008 Jul 10.Structure of daidzin, a naturally occurring anti-alcohol-addiction agent, in complex with human mitochondrial aldehyde dehydrogenase. | ||||
| REF 9 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2595). | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.