Target Information

Target General Infomation
Target ID
T56510
Former ID
TTDC00168
Target Name
Antiapoptotic protein BCL-XL
Gene Name
BCL2L1
Synonyms
Bcl-XL; Bcl2L1; Bcl2like protein 1; Apoptosis regulator Bcl-X; BCL2L1
Target Type
Clinical Trial
Disease Advanced small cell lung cancer; Relapsed or refractory chronic lymphocytic leukemia; Lymphoid malignancies [ICD9: 140-229, 140-239, 162, 162.9, 202, 204.0, 204.1, 208.9; ICD10: C33-C34, C34.90, C81-C86, C91-C95, C91.0, C91.1]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Function
Isoform Bcl-X(S) promotes apoptosis.
BioChemical Class
Bcl-2 family
Target Validation
T56510
UniProt ID
Q07817
Sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Structure
1BXL; 1G5J; 1LXL; 1MAZ; 1R2D; 1R2E; 1R2G; 1R2H; 1R2I; 1YSG; 1YSI; 1YSN; 2B48; 2LP8; 2LPC; 2M03; 2M04; 2ME8; 2ME9; 2MEJ; 2O1Y; 2O2M; 2O2N; 2P1L; 2PON; 2YJ1; 2YQ6; 2YQ7; 2YXJ; 3CVA; 3FDL; 3FDM; 3INQ; 3IO8; 3PL7; 3QKD; 3R85; 3SP7; 3SPF; 3WIZ; 3ZK6; 3ZLN; 3ZLO; 3ZLR; 4A1U; 4A1W; 4AQ3; 4BPK; 4C52; 4C5D; 4CIN; 4EHR; 4HNJ; 4IEH; 4TUH; 1BXL; 1G5J; 1LXL; 1MAZ; 1R2D; 1R2E;1R2G; 1R2H; 1R2I; 1YSG; 1YSI; 1YSN; 2B48; 2LP8; 2LPC; 2M03; 2M04; 2ME8; 2ME9; 2MEJ; 2O1Y; 2O2M; 2O2N; 2P1L; 2PON; 2YJ1; 2YQ6; 2YQ7; 2YXJ; 3CVA; 3FDL; 3FDM; 3INQ; 3IO8; 3PL7; 3QKD; 3R85; 3SP7; 3SPF; 3WIZ; 3ZK6; 3ZLN; 3ZLO; 3ZLR; 4A1U; 4A1W; 4AQ3; 4BPK; 4C52; 4C5D; 4CIN; 4EHR; 4HNJ; 4IEH; 4TUH
Drugs and Mode of Action
Drug(s) ABT-263 Drug Info Phase 2 Advanced small cell lung cancer; Relapsed or refractory chronic lymphocytic leukemia; Lymphoid malignancies [543070], [551607]
Obatoclax Drug Info Phase 2 Solid tumours [531104]
Inhibitor 4'-FLUORO-1,1'-BIPHENYL-4-CARBOXYLIC ACID Drug Info [551374]
ABT-263 Drug Info [536702], [536883], [551607]
Obatoclax Drug Info [531104]
WEHI-0103122 Drug Info [543732]
Modulator E-003 Drug Info [543732]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Ras signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
NetPath Pathway IL2 Signaling Pathway
TGF_beta_Receptor Signaling Pathway
Notch Signaling Pathway
PANTHER Pathway Apoptosis signaling pathway
CCKR signaling map ST
Pathway Interaction Database IL2 signaling events mediated by PI3K
IL3-mediated signaling events
Caspase Cascade in Apoptosis
EPO signaling pathway
IL2 signaling events mediated by STAT5
Reactome BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
The NLRP1 inflammasome
WikiPathways IL-6 signaling pathway
IL-3 Signaling Pathway
Nucleotide-binding domain, leucine rich repeat containing receptor (NLR) signaling pathways
Apoptosis
Amyotrophic lateral sclerosis (ALS)
TNF alpha Signaling Pathway
IL-7 Signaling Pathway
Leptin signaling pathway
Intrinsic Pathway for Apoptosis
Apoptosis Modulation and Signaling
References
Ref 531104Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9.
Ref 543070(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8319).
Ref 551607Clinical pipeline report, company report or official report of Roche (2009).
Ref 531104Phase II study of obatoclax mesylate (GX15-070), a small-molecule BCL-2 family antagonist, for patients with myelofibrosis. Clin Lymphoma Myeloma Leuk. 2010 Aug;10(4):285-9.
Ref 536702ABT-263: a potent and orally bioavailable Bcl-2 family inhibitor. Cancer Res. 2008 May 1;68(9):3421-8.
Ref 536883ABT-263 and rapamycin act cooperatively to kill lymphoma cells in vitro and in vivo. Mol Cancer Ther. 2008 Oct;7(10):3265-74.
Ref 543732(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2845).
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551607Clinical pipeline report, company report or official report of Roche (2009).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.