Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T58940
|
||||
Former ID |
TTDC00009
|
||||
Target Name |
5-hydroxy-tryptamine 3B receptor
|
||||
Gene Name |
HTR3B
|
||||
Synonyms |
5-HT-3B; 5-HT3B; 5-hydroxytryptamine receptor 3B; Serotonin receptor 3B; HTR3B
|
||||
Target Type |
Discontinued
|
||||
Function |
This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.
|
||||
BioChemical Class |
Neurotransmitter-gated ion-channel
|
||||
Target Validation |
T58940
|
||||
UniProt ID | |||||
Sequence |
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVY
LDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIII NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTV EDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL VYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRA VVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY LFMLGIYTITLCSLWALWGGV |
||||
Drugs and Mode of Action | |||||
Inhibitor | 2-(1H-Imidazol-4-ylmethyl)-4-phenyl-thiazole | Drug Info | [532034] | ||
2-(4-Benzyl-piperazin-1-yl)-benzothiazole | Drug Info | [533917] | |||
2-(4-Methyl-piperazin-1-yl)-quinoline | Drug Info | [525484] | |||
3-(2-Amino-ethyl)-2-methyl-1H-indol-5-ol | Drug Info | [532034] | |||
6-(4-Methyl-piperazin-1-yl)-phenanthridine | Drug Info | [525484] | |||
BEMESETRON | Drug Info | [528702] | |||
BRL-24682 | Drug Info | [526544] | |||
MESULERGINE | Drug Info | [534503] | |||
QUIPAZINE | Drug Info | [525484] | |||
SEROTONIN | Drug Info | [525484] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Serotonergic synapse | ||||
PANTHER Pathway | 5HT3 type receptor mediated signaling pathway | ||||
Reactome | Ligand-gated ion channel transport | ||||
WikiPathways | Iron uptake and transport | ||||
References | |||||
Ref 525484 | J Med Chem. 1999 May 6;42(9):1556-75.Novel potent and selective central 5-HT3 receptor ligands provided with different intrinsic efficacy. 2. Molecular basis of the intrinsic efficacy of arylpiperazine derivatives at the central 5-HT3 receptors. | ||||
Ref 526544 | J Med Chem. 2003 Feb 27;46(5):702-15.Synthesis and structure-affinity relationships of novel N-(1-ethyl-4-methylhexahydro-1,4-diazepin-6-yl)pyridine-3-carboxamides with potent serotonin 5-HT3 and dopamine D2 receptor antagonistic activity. | ||||
Ref 528702 | J Med Chem. 1992 Jan 24;35(2):310-9.Zatosetron, a potent, selective, and long-acting 5HT3 receptor antagonist: synthesis and structure-activity relationships. | ||||
Ref 532034 | J Med Chem. 1990 Jan;33(1):13-6.Aromatic thiazole derivatives: structurally novel and selective serotonin-3 receptor antagonists. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.