Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T72444
|
||||
Former ID |
TTDR00361
|
||||
Target Name |
Beta-ketoacyl-ACP synthase III
|
||||
Gene Name |
fabH
|
||||
Synonyms |
3-oxoacyl-[acyl-carrier-protein] synthase III; Acetoacetyl-ACP synthase; Acetoacetyl-acyl carrier protein synthase; Beta-ketoacyl-acyl carrier protein synthase III; Condensing enzyme FabH; EcFabH; FabH; KAS III; fabH
|
||||
Target Type |
Research
|
||||
Disease | Malaria [ICD10: B54] | ||||
Function |
Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Has some substrate specificity for acetyl-CoA. Its substrate specificity determines the biosynthesis of straight-chain of fatty acids instead of branched-chain.
|
||||
BioChemical Class |
Acyltransferase
|
||||
Target Validation |
T72444
|
||||
UniProt ID | |||||
EC Number |
EC 2.3.1.41
|
||||
Sequence |
MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAAT
RAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALS VADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLH ADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDW LVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVL LEAFGGGFTWGSALVRF |
||||
Inhibitor | 2-(3-Phenoxy-benzoylamino)-benzoic acid | Drug Info | [1] | ||
2-(4-Bromo-3-phenoxy-benzoylamino)-benzoic acid | Drug Info | [1] | |||
2-(4-chlorophenylsulfonyl)naphthalene-1,4-diol | Drug Info | [2] | |||
2-(4-Fluoro-3-phenoxy-benzoylamino)-benzoic acid | Drug Info | [1] | |||
2-(4-propylphenylsulfonyl)naphthalene-1,4-diol | Drug Info | [2] | |||
2-(methylsulfonyl)naphthalene-1,4-diol | Drug Info | [2] | |||
2-(naphthalen-2-ylsulfonyl)naphthalene-1,4-diol | Drug Info | [2] | |||
2-(p-tolylthio)naphthalene-1,4-dione | Drug Info | [2] | |||
2-(phenylsulfonyl)naphthalene-1,4-diol | Drug Info | [2] | |||
2-Fluoro-6-(3-phenoxy-benzoylamino)-benzoic acid | Drug Info | [1] | |||
2-Hydroxy-6-(3-phenoxy-benzoylamino)-benzoic acid | Drug Info | [1] | |||
2-tosylanthracene-1,4-diol | Drug Info | [2] | |||
2-tosylbenzene-1,4-diol | Drug Info | [2] | |||
2-tosylnaphthalene | Drug Info | [2] | |||
2-Tosylnaphthalene-1,4-diol | Drug Info | [2] | |||
2-tosylnaphthalene-1,4-dione | Drug Info | [2] | |||
2-[3-(Pyridin-4-yloxy)-benzoylamino]-benzoic acid | Drug Info | [1] | |||
Binder | Thiolactomycin | Drug Info | [3] | ||
References | |||||
REF 1 | J Med Chem. 2005 Mar 10;48(5):1596-609.Structure-based design, synthesis, and study of potent inhibitors of beta-ketoacyl-acyl carrier protein synthase III as potential antimicrobial agents. | ||||
REF 2 | Bioorg Med Chem Lett. 2008 Dec 15;18(24):6402-5. Epub 2008 Oct 25.Synthesis and biological evaluation of novel sulfonyl-naphthalene-1,4-diols as FabH inhibitors. | ||||
REF 3 | The apicoplast as an antimalarial drug target. Drug Resist Updat. 2001 Jun;4(3):145-51. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.