Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T03878 | Target Info | |||
Target Name | Midgestation and kidney protein (Midkine) | ||||
Synonyms | Neurite outgrowth-promoting protein; Neurite outgrowth-promoting factor 2; NEGF2; MK1; MK; Amphiregulin-associated protein; ARAP | ||||
Target Type | Literature-reported Target | ||||
Gene Name | MDK | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | Wilms tumor protein (WT1) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys2His2 zinc finger domain | ||||
Family | Developmental / cell cycle regulators | ||||
Subfamily | GLI-like | ||||
Regulation Type | Decrease | ||||
Regulation Mechanism | The high expression level of MDK in all Wilms' tumor specimens so far examined and the presence of two WT1 elements (5'-GCGGGGGCG-3') in the human MDK promoter region led us to examine the possible role of the WT1 gene product in the regulation of MDK gene expression. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAP
PPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQA SSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHED PMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ MNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV RRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDC ERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPS CQKKFARSDELVRHHNMHQRNMTKLQLAL |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
Growth factors | [+] 2 Growth factors Co-regulated By This TF | + | |||
Kinases | [+] 2 Kinases Co-regulated By This TF | + | |||
Pleiotrophins | [+] 1 Pleiotrophins Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Midkine as a novel target gene for the Wilms' tumor suppressor gene (WT1). Oncogene. 1996 Nov 21;13(10):2197-203. | ||||
REF 2 | WT1 modulates apoptosis by transcriptionally upregulating the bcl-2 proto-oncogene. EMBO J. 1999 Jul 15;18(14):3990-4003. | ||||
REF 3 | The Wilms tumor suppressor WT1 encodes a transcriptional activator of amphiregulin. Cell. 1999 Sep 3;98(5):663-73. | ||||
REF 4 | The Wilms' tumor gene product, WT1, represses transcription of the platelet-derived growth factor A-chain gene. J Biol Chem. 1992 Nov 5;267(31):21999-2002. | ||||
REF 5 | WT1 suppresses synthesis of the epidermal growth factor receptor and induces apoptosis. EMBO J. 1995 Oct 2;14(19):4662-75. | ||||
REF 6 | The Wilms' tumor 1 tumor suppressor gene represses transcription of the human telomerase reverse transcriptase gene. J Biol Chem. 1999 Dec 24;274(52):37473-8. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.