Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T13260 | Target Info | |||
| Target Name | Aromatase (CYP19A1) | ||||
| Synonyms | P-450AROM; Estrogen synthetase; Estrogen synthase; Cytochrome P450 19A1; Cytochrome P-450AROM; CYPXIX; CYP19; CYAR; ARO1 | ||||
| Target Type | Successful Target | ||||
| Gene Name | CYP19A1 | ||||
| Biochemical Class | Paired donor oxygen oxidoreductase | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | C/EBP beta (CEBPB) homodimer | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Leucine zipper factors (bZIP) | ||||
| Family | C/EBP-like factors | ||||
| Evidence Score (E-score) | 2 | + | |||
| 1 | Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay | [1] | |||
| 2 | Electrophoretic Mobility Shift Assay | [2] | |||
| UniProt ID | |||||
| Sequence |
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [3] | |
| Calcium-binding proteins | [+] 1 Calcium-binding proteins Co-regulated By This TF | + | |||
| 1 | Calgranulin B (S100A9) | Clinical trial Target | Target Info | [4] | |
| Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
| 1 | Coagulation factor VIII (F8) | Successful Target | Target Info | [5] | |
| Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | Interleukin-1 beta (IL1B) | Successful Target | Target Info | [6] | |
| Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
| 1 | Intercellular adhesion molecule ICAM-1 (ICAM1) | Successful Target | Target Info | [7] | |
| Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
| 1 | Integrin alpha-2 (ITGA2) | Clinical trial Target | Target Info | [8] | |
| Isomerases | [+] 1 Isomerases Co-regulated By This TF | + | |||
| 1 | Leishmania DNA topoisomerase I (Leishm TOP1) | Clinical trial Target | Target Info | [9] | |
| Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
| 1 | Low-density lipoprotein receptor (LDL-R) | Successful Target | Target Info | [10] | |
| Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Aromatase (CYP19A1) | Successful Target | Target Info | [1] | |
| Pentraxins | [+] 1 Pentraxins Co-regulated By This TF | + | |||
| 1 | CRP messenger RNA (CRP mRNA) | Clinical trial Target | Target Info | [11] | |
| Somatotropin / Prolactins | [+] 1 Somatotropin / Prolactins Co-regulated By This TF | + | |||
| 1 | Prolactin (PRL) | Discontinued Target | Target Info | [12] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Identification of a transcriptional regulatory factor for human aromatase cytochrome P450 gene expression as nuclear factor interleukin-6 (NF-IL6), a member of the CCAAT/enhancer-binding protein family. Eur J Biochem. 1995 Jul 15;231(2):292-9. | ||||
| REF 2 | Regulation of aromatase P450 expression in endometriotic and endometrial stromal cells by CCAAT/enhancer binding proteins (C/EBPs): decreased C/EBP... J Clin Endocrinol Metab. 2002 May;87(5):2336-45. | ||||
| REF 3 | Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48. | ||||
| REF 4 | Transcriptional regulation by C/EBP alpha and -beta in the expression of the gene for the MRP14 myeloid calcium binding protein. Cell Struct Funct. 1998 Jun;23(3):109-18. | ||||
| REF 5 | cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38. | ||||
| REF 6 | Human T-cell leukemia virus type I Tax transactivates the promoter of human prointerleukin-1beta gene through association with two transcription factors, nuclear factor-interleukin-6 and Spi-1. Blood. 1997 Oct 15;90(8):3142-53. | ||||
| REF 7 | Regulatory elements and transcription factors controlling basal and cytokine-induced expression of the gene encoding intercellular adhesion molecule 1. Proc Natl Acad Sci U S A. 1994 Nov 22;91(24):11641-5. | ||||
| REF 8 | The alpha2 and alpha5 integrin genes: identification of transcription factors that regulate promoter activity in epidermal keratinocytes. FEBS Lett. 2000 Jun 2;474(2-3):201-7. | ||||
| REF 9 | The human topoisomerase I gene promoter is regulated by NF-IL6. Mol Cell Biol. 1995 Dec;15(12):6623-31. | ||||
| REF 10 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. | ||||
| REF 11 | Constitutive and IL-6-induced nuclear factors that interact with the human C-reactive protein promoter. EMBO J. 1990 Feb;9(2):457-65. | ||||
| REF 12 | CCAAT/enhancer-binding proteins are mediators in the protein kinase A-dependent activation of the decidual prolactin promoter. J Biol Chem. 1999 Aug 27;274(35):24808-18. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.