Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T19579 | Target Info | |||
Target Name | Interleukin 2 receptor beta (IL2RB) | ||||
Synonyms | P70-75; Interleukin-2 receptor subunit beta; Interleukin-15 receptor subunit beta; IL15RB; IL-2RB; IL-2R subunit beta; IL-2 receptor subunit beta; IL-2 receptor; High affinity IL-2 receptor subunit beta; CD122 | ||||
Target Type | Clinical trial Target | ||||
Gene Name | IL2RB | ||||
Biochemical Class | Cytokine receptor | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | ETS proto-oncogene 1 (C-ets-1) | ||||
Classification | Superclass | Helix-turn-helix | |||
Class | Tryptophan clusters | ||||
Family | Ets-type | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The enhancer of the IL2RB gene contains a GGAA Ets binding site which bound two Ets family proteins, Ets-1 and GABP in vitro. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS LLGYTPEELHAMLDVKPDADE |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
TF Name | GA-binding protein (GABP) heterotetramer | ||||
Classification | Superclass | Helix-turn-helix | |||
Class | Tryptophan clusters | ||||
Family | Ets-type | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The enhancer of the IL2RB gene contains a GGAA Ets binding site which bound two Ets family proteins, Ets-1 and GABP in vitro. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
Zinc-fingers | [+] 1 Zinc-fingers Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Characterization of the human interleukin-2 receptor beta-chain gene promoter: regulation of promoter activity by ets gene products. Mol Cell Biol. 1993 Oct;13(10):6201-10. | ||||
REF 2 | Pi 1 binding sites are negative regulators of bcl-2 expression in pre-B cells. Mol Cell Biol. 1995 Jul;15(7):3840-7. | ||||
REF 3 | Transcription factors ets1, NF-kappa B, and Sp1 are major determinants of the promoter activity of the human protein kinase CK2alpha gene. J Biol Chem. 2000 Jun 16;275(24):18327-36. | ||||
REF 4 | Transcriptional regulation of endothelial nitric-oxide synthase by lysophosphatidylcholine. J Biol Chem. 1998 Jun 12;273(24):14885-90. | ||||
REF 5 | The human caspase-8 promoter sustains basal activity through SP1 and ETS-like transcription factors and can be up-regulated by a p53-dependent mechanism. J Biol Chem. 2003 Jul 25;278(30):27593-604. | ||||
REF 6 | The human beta 2 integrin CD18 promoter consists of two inverted Ets cis elements. Mol Cell Biol. 1994 Apr;14(4):2604-15. | ||||
REF 7 | Binding of the Ets factor GA-binding protein to an upstream site in the factor IX promoter is a critical event in transactivation. Mol Cell Biol. 1996 May;16(5):1929-35. | ||||
REF 8 | Induction of utrophin gene expression by heregulin in skeletal muscle cells: role of the N-box motif and GA binding protein. Proc Natl Acad Sci U S A. 1999 Mar 16;96(6):3223-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.