Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T13852
(Former ID: TTDC00258)
|
|||||
Target Name |
Sphingosine-1-phosphate receptor 1 (S1PR1)
|
|||||
Synonyms |
Sphingosine 1-phosphate receptor Edg-1; S1P1; S1P receptor Edg-1; S1P receptor 1; Endothelial differentiation G-protein coupled receptor 1; CHEDG1; CD363
|
|||||
Gene Name |
S1PR1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Multiple sclerosis [ICD-11: 8A40] | |||||
Function |
Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury. G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH PQKDEGDNPETIMSSGNVNSSS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T12CH9 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 4 Approved Drugs | + | ||||
1 | Fingolimod | Drug Info | Approved | Primary progressive multiple sclerosis | [1], [2] | |
2 | Ozanimod | Drug Info | Approved | Multiple sclerosis | [3] | |
3 | Ponesimod | Drug Info | Approved | Multiple sclerosis | [4] | |
4 | Siponimod | Drug Info | Approved | Multiple sclerosis | [5] | |
Clinical Trial Drug(s) | [+] 11 Clinical Trial Drugs | + | ||||
1 | APD-334 | Drug Info | Phase 3 | Ulcerative colitis | [6] | |
2 | KRP-203 | Drug Info | Phase 2 | Cutaneous lupus erythematosus | [7] | |
3 | MT-1303 | Drug Info | Phase 2 | Multiple sclerosis | [8] | |
4 | ONO-4641 | Drug Info | Phase 2 | Rheumatoid arthritis | [9] | |
5 | ASP-4058 | Drug Info | Phase 1 | Multiple sclerosis | [10] | |
6 | BMS-986104 | Drug Info | Phase 1 | Rheumatoid arthritis | [11] | |
7 | CS-0777 | Drug Info | Phase 1 | Multiple sclerosis | [12] | |
8 | GSK-2018682 | Drug Info | Phase 1 | Immune System disease | [13] | |
9 | SAR247799 | Drug Info | Phase 1 | Cardiovascular disease | [14] | |
10 | Sonepcizumab | Drug Info | Phase 1 | Macular degeneration | [15] | |
11 | Sphingosine-1-phosphate | Drug Info | Phase 1 | Acne vulgaris | [16], [17] | |
Discontinued Drug(s) | [+] 2 Discontinued Drugs | + | ||||
1 | PF-4629991 | Drug Info | Discontinued in Phase 1 | Rheumatoid arthritis | [18] | |
2 | XL-541 | Drug Info | Terminated | Solid tumour/cancer | [19] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Modulator | [+] 8 Modulator drugs | + | ||||
1 | Fingolimod | Drug Info | [1], [20] | |||
2 | Siponimod | Drug Info | [5] | |||
3 | MT-1303 | Drug Info | [24] | |||
4 | ASP-4058 | Drug Info | [10] | |||
5 | BMS-986104 | Drug Info | [11] | |||
6 | CS-0777 | Drug Info | [26], [27] | |||
7 | KRP-107 | Drug Info | [38] | |||
8 | NIBR-785 | Drug Info | [38] | |||
Agonist | [+] 18 Agonist drugs | + | ||||
1 | Ozanimod | Drug Info | [3] | |||
2 | Ponesimod | Drug Info | [4] | |||
3 | APD-334 | Drug Info | [11], [21] | |||
4 | KRP-203 | Drug Info | [22], [23] | |||
5 | ONO-4641 | Drug Info | [22], [25] | |||
6 | GSK-2018682 | Drug Info | [22] | |||
7 | SAR247799 | Drug Info | [14] | |||
8 | PF-4629991 | Drug Info | [31] | |||
9 | AFD(R) | Drug Info | [37] | |||
10 | AUY954 | Drug Info | [39] | |||
11 | BMS-520 | Drug Info | [38] | |||
12 | CYM5181 | Drug Info | [40] | |||
13 | CYM5442 | Drug Info | [40] | |||
14 | FTY720-phosphate | Drug Info | [37] | |||
15 | GSK-1842799C | Drug Info | [38] | |||
16 | KRP 203-phosphate | Drug Info | [42] | |||
17 | LPA | Drug Info | [43] | |||
18 | SEW2871 | Drug Info | [45] | |||
Inhibitor | [+] 15 Inhibitor drugs | + | ||||
1 | Sphingosine-1-phosphate | Drug Info | [30] | |||
2 | (3-Tetradecylamino-cyclohexyl)-phosphonic acid | Drug Info | [33] | |||
3 | (3-Tetradecylamino-cyclopentyl)-phosphonic acid | Drug Info | [33] | |||
4 | (S)-FTY720P | Drug Info | [34] | |||
5 | 1-(4-nonylbenzyl)azetidine-3-carboxylic acid | Drug Info | [35] | |||
6 | 1-(4-nonylbenzyl)pyrrolidin-3-ylphosphonic acid | Drug Info | [35] | |||
7 | 1-(4-nonylbenzyl)pyrrolidine-3-carboxylic acid | Drug Info | [35] | |||
8 | 3-(N-alkylamino) propylphosphonic acid derivative | Drug Info | [33] | |||
9 | 3-(tetradecylamino)propylphosphonic acid | Drug Info | [35] | |||
10 | 3-amino-5-(4-octylphenyl)pentanoic acid | Drug Info | [36] | |||
11 | 4-amino-6-(4-octylphenyl)hexanoic acid | Drug Info | [36] | |||
12 | GNF-PF-78 | Drug Info | [41] | |||
13 | GNF-PF-826 | Drug Info | [41] | |||
14 | NOX-S91 | Drug Info | [38] | |||
15 | [3-(4-Nonyl-benzylamino)-propyl]-phosphonic acid | Drug Info | [33] | |||
Antagonist | [+] 7 Antagonist drugs | + | ||||
1 | XL-541 | Drug Info | [32] | |||
2 | AMG-247 | Drug Info | [38] | |||
3 | NIBR-0213 | Drug Info | [44] | |||
4 | VPC03090-P | Drug Info | [46] | |||
5 | VPC23019 | Drug Info | [47] | |||
6 | VPC44116 | Drug Info | [48] | |||
7 | W146 | Drug Info | [49] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) | ||||||
Drug Resistance Mutation (DRM) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | FoxO signaling pathway | |||||
2 | Sphingolipid signaling pathway | |||||
3 | Neuroactive ligand-receptor interaction | |||||
NetPath Pathway | [+] 3 NetPath Pathways | + | ||||
1 | IL4 Signaling Pathway | |||||
2 | TGF_beta_Receptor Signaling Pathway | |||||
3 | IL2 Signaling Pathway | |||||
PID Pathway | [+] 5 PID Pathways | + | ||||
1 | Fc-epsilon receptor I signaling in mast cells | |||||
2 | S1P3 pathway | |||||
3 | S1P1 pathway | |||||
4 | Sphingosine 1-phosphate (S1P) pathway | |||||
5 | PDGFR-beta signaling pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | G alpha (i) signalling events | |||||
2 | Lysosphingolipid and LPA receptors | |||||
WikiPathways | [+] 5 WikiPathways | + | ||||
1 | Signal Transduction of S1P Receptor | |||||
2 | Small Ligand GPCRs | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling | |||||
5 | GPCRs, Other |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2407). | |||||
REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020 | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2021 | |||||
REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
REF 6 | ClinicalTrials.gov (NCT03996369) Etrasimod Versus Placebo as Induction Therapy in Moderately to Severely Active Ulcerative Colitis (ELEVATE UC 12). U.S. National Institutes of Health. | |||||
REF 7 | ClinicalTrials.gov (NCT01294774) Safety and Efficacy of KRP203 in Subacute Cutaneous Lupus Erythematosus. U.S. National Institutes of Health. | |||||
REF 8 | ClinicalTrials.gov (NCT01890655) Extension Study of MT-1303. U.S. National Institutes of Health. | |||||
REF 9 | ClinicalTrials.gov (NCT01226745) A Safety and Efficacy Extension Study of ONO-4641 (MSC2430913A) in Patients With Relapsing-Remitting Multiple Sclerosis. U.S. National Institutes of Health. | |||||
REF 10 | ASP4058, a novel agonist for sphingosine 1-phosphate receptors 1 and 5, ameliorates rodent experimental autoimmune encephalomyelitis with a favorable safety profile. PLoS One. 2014 Oct 27;9(10):e110819. | |||||
REF 11 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 12 | ClinicalTrials.gov (NCT00616733) 12-week Safety Evaluation of Oral CS-0777 in Multiple Sclerosis Patients. U.S. National Institutes of Health. | |||||
REF 13 | ClinicalTrials.gov (NCT01387217) GSK2018682 FTIH in Healthy Volunteers. U.S. National Institutes of Health. | |||||
REF 14 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 15 | ClinicalTrials.gov (NCT00661414) Safety Study of ASONEP (Sonepcizumab/LT1009) to Treat Advanced Solid Tumors. U.S. National Institutes of Health. | |||||
REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 911). | |||||
REF 17 | ClinicalTrials.gov (NCT01466322) A Study to Assess the Relative Bioavailability of Different Formulations of GSK2018682, a Sphingosine-1-phosphate Receptor Subtype 1 Agonist, in Healthy Volunteers.. U.S. National Institutes of Health. | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030004) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029368) | |||||
REF 20 | Emerging oral drugs for multiple sclerosis. Expert Opin Emerg Drugs. 2008 Sep;13(3):465-77. | |||||
REF 21 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 22 | Targeting the sphingosine-1-phosphate axis in cancer, inflammation and beyond. Nat Rev Drug Discov. 2013 Sep;12(9):688-702. | |||||
REF 23 | KRP-203, sphingosine 1-phosphate receptor type 1 agonist, ameliorates atherosclerosis in LDL-R-/- mice. Arterioscler Thromb Vasc Biol. 2013 Jul;33(7):1505-12. | |||||
REF 24 | Sphingosine 1-Phosphate Receptor Modulators in Multiple Sclerosis. CNS Drugs. 2015 Jul;29(7):565-75. | |||||
REF 25 | Efficacy and immunomodulatory actions of ONO-4641, a novel selective agonist for sphingosine 1-phosphate receptors 1 and 5, in preclinical models of multiple sclerosis. Clin Exp Immunol. 2013 Jan;171(1):54-62. | |||||
REF 26 | Discovery of CS-0777: A Potent, Selective, and Orally Active S1P1 Agonist. ACS Med Chem Lett. 2011 Mar 2;2(5):368-72. | |||||
REF 27 | Pharmacological effects of CS-0777, a selective sphingosine 1-phosphate receptor-1 modulator: results from a 12-week, open-label pilot study in multiple sclerosis patients. J Neuroimmunol. 2012 May 15;246(1-2):100-7. | |||||
REF 28 | National Cancer Institute Drug Dictionary (drug id 595163). | |||||
REF 29 | Prevention of ocular scarring after glaucoma filtering surgery using the monoclonal antibody LT1009 (Sonepcizumab) in a rabbit model. J Glaucoma. 2013 Feb;22(2):145-51. | |||||
REF 30 | Exploration of amino alcohol derivatives as novel, potent, and highly selective sphingosine-1-phosphate receptor subtype-1 agonists. Bioorg Med Chem Lett. 2010 Apr 15;20(8):2520-4. | |||||
REF 31 | US patent application no. 2010,0158,905, Combination therapy of arthritis with tranilast. | |||||
REF 32 | Discovery of a novel class of potent and orally bioavailable sphingosine 1-phosphate receptor 1 antagonists. J Med Chem. 2012 Feb 9;55(3):1368-81. | |||||
REF 33 | Design and synthesis of conformationally constrained 3-(N-alkylamino)propylphosphonic acids as potent agonists of sphingosine-1-phosphate (S1P) rec... Bioorg Med Chem Lett. 2004 Oct 4;14(19):4861-6. | |||||
REF 34 | Persistent signaling induced by FTY720-phosphate is mediated by internalized S1P1 receptors. Nat Chem Biol. 2009 Jun;5(6):428-34. | |||||
REF 35 | A rational utilization of high-throughput screening affords selective, orally bioavailable 1-benzyl-3-carboxyazetidine sphingosine-1-phosphate-1 re... J Med Chem. 2004 Dec 30;47(27):6662-5. | |||||
REF 36 | S1P receptor mediated activity of FTY720 phosphate mimics. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1485-7. | |||||
REF 37 | The immune modulator FTY720 targets sphingosine 1-phosphate receptors. J Biol Chem. 2002 Jun 14;277(24):21453-7. | |||||
REF 38 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 275). | |||||
REF 39 | A monoselective sphingosine-1-phosphate receptor-1 agonist prevents allograft rejection in a stringent rat heart transplantation model. Chem Biol. 2006 Nov;13(11):1227-34. | |||||
REF 40 | Full pharmacological efficacy of a novel S1P1 agonist that does not require S1P-like headgroup interactions. Mol Pharmacol. 2008 Nov;74(5):1308-18. | |||||
REF 41 | In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. | |||||
REF 42 | A novel sphingosine 1-phosphate receptor agonist, 2-amino-2-propanediol hydrochloride (KRP-203), regulates chronic colitis in interleukin-10 gene-d... J Pharmacol Exp Ther. 2008 Jan;324(1):276-83. | |||||
REF 43 | Lysophosphatidic acid stimulates the G-protein-coupled receptor EDG-1 as a low affinity agonist. J Biol Chem. 1998 Aug 21;273(34):22105-12. | |||||
REF 44 | A potent and selective S1P(1) antagonist with efficacy in experimental autoimmune encephalomyelitis. Chem Biol. 2012 Sep 21;19(9):1142-51. | |||||
REF 45 | Sphingosine 1-phosphate (S1P) receptor subtypes S1P1 and S1P3, respectively, regulate lymphocyte recirculation and heart rate. J Biol Chem. 2004 Apr 2;279(14):13839-48. | |||||
REF 46 | Characterization of a sphingosine 1-phosphate receptor antagonist prodrug. J Pharmacol Exp Ther. 2011 Sep;338(3):879-89. | |||||
REF 47 | Sphingosine 1-phosphate analogs as receptor antagonists. J Biol Chem. 2005 Mar 18;280(11):9833-41. | |||||
REF 48 | Synthesis and biological evaluation of gamma-aminophosphonates as potent, subtype-selective sphingosine 1-phosphate receptor agonists and antagonists. Bioorg Med Chem. 2007 Jan 15;15(2):663-77. | |||||
REF 49 | Enhancement of capillary leakage and restoration of lymphocyte egress by a chiral S1P1 antagonist in vivo. Nat Chem Biol. 2006 Aug;2(8):434-41. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.