Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T67684
(Former ID: TTDS00004)
|
|||||
Target Name |
Muscarinic acetylcholine receptor M3 (CHRM3)
|
|||||
Synonyms |
M3 receptor; CHRM3
|
|||||
Gene Name |
CHRM3
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 10 Target-related Diseases | + | ||||
1 | Asthma [ICD-11: CA23] | |||||
2 | Chronic obstructive pulmonary disease [ICD-11: CA22] | |||||
3 | Functional bladder disorder [ICD-11: GC50] | |||||
4 | Glaucoma [ICD-11: 9C61] | |||||
5 | Nausea/vomiting [ICD-11: MD90] | |||||
6 | Peptic ulcer [ICD-11: DA61] | |||||
7 | Respiratory system disease [ICD-11: CB40-CB7Z] | |||||
8 | Sebaceous gland disorder [ICD-11: ED91] | |||||
9 | Sjogren syndrome [ICD-11: 4A43] | |||||
10 | Tonus and reflex abnormality [ICD-11: MB47] | |||||
Function |
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A05818 | |||||
HIT2.0 ID | T93KNA |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 13 Approved Drugs | + | ||||
1 | ACECLIDINE | Drug Info | Approved | Glaucoma/ocular hypertension | [2], [3] | |
2 | Cevimeline | Drug Info | Approved | Sjogren syndrome | [4] | |
3 | Darifenacin | Drug Info | Approved | Overactive bladder | [5], [6], [7] | |
4 | Ipratropium | Drug Info | Approved | Obstructive lung disease | [8], [9] | |
5 | LAS-34273 | Drug Info | Approved | Chronic obstructive pulmonary disease | [10], [11] | |
6 | Methacholine Chloride | Drug Info | Approved | bronchial hyperreactivity | [3] | |
7 | Methscopolamine Bromide | Drug Info | Approved | Nausea and vomiting | [3] | |
8 | Methylscopolamine | Drug Info | Approved | Peptic ulcer | [3], [12], [13] | |
9 | SMT-D002 | Drug Info | Approved | Seborrhea | [14] | |
10 | Solifenacin | Drug Info | Approved | Overactive bladder | [15], [16] | |
11 | Succinylcholine | Drug Info | Approved | Spasm | [3], [17], [18] | |
12 | Tiotropium | Drug Info | Approved | Chronic obstructive pulmonary disease | [19], [6] | |
13 | Tolterodine | Drug Info | Approved | Overactive bladder | [3] | |
Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
1 | Tarafenacin | Drug Info | Phase 2 | Overactive bladder | [20] | |
2 | TRN-157 | Drug Info | Phase 2 | Chronic obstructive pulmonary disease | [21] | |
3 | CHF 5407 | Drug Info | Phase 1 | Chronic obstructive pulmonary disease | [22] | |
Discontinued Drug(s) | [+] 4 Discontinued Drugs | + | ||||
1 | Zamifenacin | Drug Info | Discontinued in Phase 3 | Urinary incontinence | [23] | |
2 | PSD-506 | Drug Info | Discontinued in Phase 2 | Overactive bladder | [24] | |
3 | Revatropate | Drug Info | Discontinued in Phase 1 | Chronic obstructive pulmonary disease | [25] | |
4 | Alvameline | Drug Info | Terminated | Alzheimer disease | [26] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Inhibitor | [+] 36 Inhibitor drugs | + | ||||
1 | ACECLIDINE | Drug Info | [27] | |||
2 | 1'-Benzyl-3-phenyl-[3,4']bipiperidinyl-2,6-dione | Drug Info | [48] | |||
3 | 1,1-diphenyl-2-(3-tropanyl)ethanol | Drug Info | [49] | |||
4 | 1-Methyl-1-(4-pyrrolidin-1-yl-but-2-ynyl)-urea | Drug Info | [50] | |||
5 | 2,8-Dimethyl-1-oxa-8-aza-spiro[4.5]decan-3-one | Drug Info | [51] | |||
6 | 2-Methyl-6-pyrrolidin-1-yl-hex-4-ynal oxime | Drug Info | [52] | |||
7 | 3-(3-benzylamino)-piperidin-2-one | Drug Info | [53] | |||
8 | 3-Methyl-7-pyrrolidin-1-yl-hept-5-yn-2-one | Drug Info | [52] | |||
9 | 3-Tetrazol-2-yl-1-aza-bicyclo[2.2.2]octane | Drug Info | [54] | |||
10 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [55] | |||
11 | 6-Dimethylamino-2-methyl-hex-4-ynal oxime | Drug Info | [52] | |||
12 | 7-Dimethylamino-3-methyl-hept-5-yn-2-one | Drug Info | [52] | |||
13 | 7-Dimethylamino-hept-5-yn-2-one | Drug Info | [52] | |||
14 | 7-Pyrrolidin-1-yl-hept-5-yn-2-one | Drug Info | [52] | |||
15 | A-987306 | Drug Info | [58] | |||
16 | Acetic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [59] | |||
17 | Benzoic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [61] | |||
18 | BRL-55473 | Drug Info | [62] | |||
19 | Cremastrine | Drug Info | [64] | |||
20 | FLUMEZAPINE | Drug Info | [67] | |||
21 | FM1-10 | Drug Info | [68] | |||
22 | FM1-43 | Drug Info | [68] | |||
23 | GNF-PF-5618 | Drug Info | [69] | |||
24 | ISOCLOZAPINE | Drug Info | [73] | |||
25 | ISOLOXAPINE | Drug Info | [74] | |||
26 | N-(4-Dimethylamino-but-2-ynyl)-N-methyl-acetamide | Drug Info | [52] | |||
27 | N-methoxyquinuclidine-3-carboximidoyl chloride | Drug Info | [62] | |||
28 | N-methoxyquinuclidine-3-carboximidoyl fluoride | Drug Info | [62] | |||
29 | NOCARDIMICIN A | Drug Info | [69] | |||
30 | Nocardimicin C | Drug Info | [69] | |||
31 | Nocardimicin D | Drug Info | [69] | |||
32 | Nocardimicin F | Drug Info | [69] | |||
33 | Noccardimicin E | Drug Info | [69] | |||
34 | Propionic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [61] | |||
35 | SULFOARECOLINE | Drug Info | [82] | |||
36 | UCB-101333-3 | Drug Info | [85] | |||
Agonist | [+] 12 Agonist drugs | + | ||||
1 | Cevimeline | Drug Info | [28] | |||
2 | SMT-D002 | Drug Info | [35] | |||
3 | arecaidine propargyl ester | Drug Info | [60] | |||
4 | furtrethonium | Drug Info | [60] | |||
5 | J-104135 | Drug Info | [43] | |||
6 | McN-A-343 | Drug Info | [76] | |||
7 | methylfurmethide | Drug Info | [60] | |||
8 | NNC 11-1314 | Drug Info | [78] | |||
9 | NNC 11-1585 | Drug Info | [78] | |||
10 | NNC 11-1607 | Drug Info | [78] | |||
11 | pentylthio-TZTP | Drug Info | [60] | |||
12 | [3H]oxotremorine-M | Drug Info | [60] | |||
Antagonist | [+] 27 Antagonist drugs | + | ||||
1 | Darifenacin | Drug Info | [29], [30] | |||
2 | LAS-34273 | Drug Info | [25] | |||
3 | Methylscopolamine | Drug Info | [34] | |||
4 | Solifenacin | Drug Info | [36] | |||
5 | Succinylcholine | Drug Info | [37], [38] | |||
6 | Tiotropium | Drug Info | [1], [39] | |||
7 | Tolterodine | Drug Info | [40], [41] | |||
8 | Tarafenacin | Drug Info | [42] | |||
9 | TRN-157 | Drug Info | [43] | |||
10 | Zamifenacin | Drug Info | [45] | |||
11 | 3-(1-carbamoyl-1,1-diphenylmethyl)-1-(4-methoxyphenylethyl)pyrrolidine (APP) | Drug Info | [40] | |||
12 | 4-DAMP | Drug Info | [56], [57] | |||
13 | AE-9C90CB | Drug Info | [43] | |||
14 | guanylpirenzepine | Drug Info | [71] | |||
15 | hexahydrodifenidol | Drug Info | [72] | |||
16 | hexahydrosiladifenidol | Drug Info | [72] | |||
17 | lithocholylcholine | Drug Info | [75] | |||
18 | ML381 | Drug Info | [77] | |||
19 | Olterodine | Drug Info | [79] | |||
20 | Oxybutynine | Drug Info | [80] | |||
21 | p-F-HHSiD | Drug Info | [81] | |||
22 | PTAC | Drug Info | [79] | |||
23 | silahexocyclium | Drug Info | [72] | |||
24 | tripitramine | Drug Info | [84] | |||
25 | UH-AH 37 | Drug Info | [86] | |||
26 | VU0255035 | Drug Info | [87] | |||
27 | [3H]QNB | Drug Info | [89] | |||
Modulator | [+] 9 Modulator drugs | + | ||||
1 | Ipratropium | Drug Info | [31] | |||
2 | Methacholine Chloride | Drug Info | [32] | |||
3 | Methscopolamine Bromide | Drug Info | [33] | |||
4 | CHF 5407 | Drug Info | [44] | |||
5 | PSD-506 | Drug Info | [46] | |||
6 | Revatropate | Drug Info | [47] | |||
7 | Alvameline | Drug Info | [26] | |||
8 | DAU-5750 | Drug Info | [65] | |||
9 | DAU-5884 | Drug Info | [66] | |||
Modulator (allosteric modulator) | [+] 8 Modulator (allosteric modulator) drugs | + | ||||
1 | brucine | Drug Info | [63] | |||
2 | Go7874 | Drug Info | [70] | |||
3 | N-benzyl brucine | Drug Info | [63] | |||
4 | N-chloromethyl-brucine | Drug Info | [63] | |||
5 | thiochrome | Drug Info | [83] | |||
6 | vinburnine | Drug Info | [60] | |||
7 | WIN 51,708 | Drug Info | [88] | |||
8 | WIN 62,577 | Drug Info | [88] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | DrugBank: a knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008 Jan;36(Database issue):D901-6. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 288). | |||||
REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 4 | Therapeutic effect of cevimeline on dry eye in patients with Sj gren's syndrome: a randomized, double-blind clinical study. Am J Ophthalmol. 2004 Jul;138(1):6-17. | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 321). | |||||
REF 6 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
REF 7 | 2004 approvals: the demise of the blockbuster. Nat Rev Drug Discov. 2005 Feb;4(2):93-4. | |||||
REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 325). | |||||
REF 9 | Emerging drugs for postoperative ileus. Expert Opin Emerg Drugs. 2007 Nov;12(4):619-26. | |||||
REF 10 | Nat Rev Drug Discov. 2013 Feb;12(2):87-90. | |||||
REF 11 | Aclidinium bromide, a novel long-acting muscarinic M3 antagonist for the treatment of COPD. Curr Opin Investig Drugs. 2009 May;10(5):482-90. | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 316). | |||||
REF 13 | Drug information of Methylscopolamine, 2008. eduDrugs. | |||||
REF 14 | Clinical pipeline report, company report or official report of Summit. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7483). | |||||
REF 16 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 021518. | |||||
REF 17 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4004). | |||||
REF 18 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 008453. | |||||
REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 367). | |||||
REF 20 | ClinicalTrials.gov (NCT01458197) A Phase 2 Study to Compare the Efficacy and Tolerability of Tarafenacin 0.2 mg and Tarafenacin 0.4 mg to Placebo in Patients Suffering From Overactive Bladder.. U.S. National Institutes of Health. | |||||
REF 21 | ClinicalTrials.gov (NCT02382510) Multiple Ascending Dose Study of TRN-157 in Stable Mild and Moderate Asthmatics. U.S. National Institutes of Health. | |||||
REF 22 | Emerging drugs in chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2009 Mar;14(1):181-94. | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003650) | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022973) | |||||
REF 25 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | |||||
REF 26 | In vivo muscarinic cholinergic mediated effects of Lu 25-109, a M1 agonist and M2/M3 antagonist in vitro. Psychopharmacology (Berl). 1998 Jun;137(3):233-40. | |||||
REF 27 | Design, synthesis, and neurochemical evaluation of 5-(3-alkyl-1,2,4- oxadiazol-5-yl)-1,4,5,6-tetrahydropyrimidines as M1 muscarinic receptor agonists. J Med Chem. 1993 Apr 2;36(7):842-7. | |||||
REF 28 | Degradation of submandibular gland AQP5 by parasympathetic denervation of chorda tympani and its recovery by cevimeline, an M3 muscarinic receptor ... Am J Physiol Gastrointest Liver Physiol. 2008 Jul;295(1):G112-G123. | |||||
REF 29 | M(1) and M(3) muscarinic receptors are involved in the release of urinary bladder-derived relaxant factor. Pharmacol Res. 2009 May;59(5):300-5. | |||||
REF 30 | Characterisation of [3H]-darifenacin as a novel radioligand for the study of muscarinic M3 receptors. J Recept Signal Transduct Res. 1997 Jan-May;17(1-3):177-84. | |||||
REF 31 | Role of parasympathetic nerves and muscarinic receptors in allergy and asthma.Chem Immunol Allergy.2012;98:48-69. | |||||
REF 32 | Muscarinic M3-receptors mediate cholinergic synergism of mitogenesis in airway smooth muscle. Am J Respir Cell Mol Biol. 2003 Feb;28(2):257-62. | |||||
REF 33 | Agonist-regulated alteration of the affinity of pancreatic muscarinic cholinergic receptors. J Biol Chem. 1993 Oct 25;268(30):22436-43. | |||||
REF 34 | Interaction of neuromuscular blocking drugs with recombinant human m1-m5 muscarinic receptors expressed in Chinese hamster ovary cells. Br J Pharmacol. 1998 Nov;125(5):1088-94. | |||||
REF 35 | Demonstration of bladder selective muscarinic receptor binding by intravesical oxybutynin to treat overactive bladder. J Urol. 2004 Nov;172(5 Pt 1):2059-64. | |||||
REF 36 | Comparison of muscarinic receptor selectivity of solifenacin and oxybutynin in the bladder and submandibular gland of muscarinic receptor knockout ... Eur J Pharmacol. 2009 Aug 1;615(1-3):201-6. | |||||
REF 37 | The involvement of histaminic and muscarinic receptors in the bronchoconstriction induced by myorelaxant administration in sensitized rabbits. Anesth Analg. 2008 Dec;107(6):1899-906. | |||||
REF 38 | Neuromuscular relaxants as antagonists for M2 and M3 muscarinic receptors. Anesthesiology. 1998 Mar;88(3):744-50. | |||||
REF 39 | Pharmacological characterization of GSK573719 (umeclidinium): a novel, long-acting, inhaled antagonist of the muscarinic cholinergic receptors for treatment of pulmonary diseases. J Pharmacol Exp Ther. 2013 May;345(2):260-70. | |||||
REF 40 | Signal transduction underlying carbachol-induced contraction of human urinary bladder. J Pharmacol Exp Ther. 2004 Jun;309(3):1148-53. | |||||
REF 41 | Knockouts model the 100 best-selling drugs--will they model the next 100 Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | |||||
REF 42 | In vivo and in vitro pharmacological characterization of SVT-40776, a novel M3 muscarinic receptor antagonist, for the treatment of overactive bladder. Br J Pharmacol. 2009 Mar;156(5):807-17. | |||||
REF 43 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 15). | |||||
REF 44 | Bronchodilator activity of (3R)-3-[[[(3-fluorophenyl)[(3,4,5-trifluorophenyl)methyl]amino] carbonyl]oxy]-1-[2-oxo-2-(2-thienyl)ethyl]-1-azoniabicyc... J Pharmacol Exp Ther. 2010 Dec;335(3):622-35. | |||||
REF 45 | Drug treatment options for irritable bowel syndrome: managing for success. Drugs Aging. 2001;18(3):201-11. | |||||
REF 46 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
REF 47 | Discovery & development of selective M3 antagonists for clinical use.Life Sci.1997;60(13-14):1053-60. | |||||
REF 48 | Synthesis and biological evaluation of [125I]- and [123I]-4-iododexetimide, a potent muscarinic cholinergic receptor antagonist. J Med Chem. 1989 May;32(5):1057-62. | |||||
REF 49 | Discovery of (3-endo)-3-(2-cyano-2,2-diphenylethyl)-8,8-dimethyl-8-azoniabicyclo[3.2.1]octane bromide as an efficacious inhaled muscarinic acetylch... Bioorg Med Chem Lett. 2009 Aug 15;19(16):4560-2. | |||||
REF 50 | Urea and 2-imidazolidone derivatives of the muscarinic agents oxotremorine and N-methyl-N-(1-methyl-4-pyrrolidino-2-butynyl)acetamide. J Med Chem. 1992 Aug 21;35(17):3270-9. | |||||
REF 51 | Synthesis and modeling studies of a potent conformationally rigid muscarinic agonist: 1-azabicyclo[2.2.1]heptanespirofuranone. J Med Chem. 1998 Oct 22;41(22):4181-5. | |||||
REF 52 | Cholinergic agents: aldehyde, ketone, and oxime analogues of the muscarinic agonist UH5, Bioorg. Med. Chem. Lett. 2(8):803-808 (1992). | |||||
REF 53 | Designing active template molecules by combining computational de novo design and human chemist's expertise. J Med Chem. 2007 Apr 19;50(8):1925-32. | |||||
REF 54 | Synthesis and muscarinic activities of quinuclidin-3-yltriazole and -tetrazole derivatives. J Med Chem. 1992 Apr 3;35(7):1280-90. | |||||
REF 55 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 56 | An increase in intracelluar free calcium ions modulated by cholinergic receptors in rat facial nucleus. Chin Med J (Engl). 2009 May 5;122(9):1049-55. | |||||
REF 57 | The effects of the antagonists of muscarinic acetylcholine receptor subtypes in rat brain on urinary bladder contraction. Nippon Hinyokika Gakkai Zasshi. 2002 Mar;93(3):427-34. | |||||
REF 58 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 59 | 6beta-Acetoxynortropane: a potent muscarinic agonist with apparent selectivity toward M2-receptors. J Med Chem. 1998 Jun 4;41(12):2047-55. | |||||
REF 60 | Positive cooperativity of acetylcholine and other agonists with allosteric ligands on muscarinic acetylcholine receptors. Mol Pharmacol. 1997 Jul;52(1):172-9. | |||||
REF 61 | 6beta-Acyloxy(nor)tropanes: affinities for antagonist/agonist binding sites on transfected and native muscarinic receptors. J Med Chem. 2000 Jun 29;43(13):2514-22. | |||||
REF 62 | A novel and selective class of azabicyclic muscarinic agonists incorporating an N-methoxy imidoyl halide or nitrile functionality, Bioorg. Med. Chem. Lett. 2(8):791-796 (1992). | |||||
REF 63 | Subtype-selective positive cooperative interactions between brucine analogues and acetylcholine at muscarinic receptors: radioligand binding studies. Mol Pharmacol. 1998 Mar;53(3):573-89. | |||||
REF 64 | Cremastrine, a pyrrolizidine alkaloid from Cremastra appendiculata. J Nat Prod. 2005 Apr;68(4):572-3. | |||||
REF 65 | Synthesis, absolute configuration, conformational analysis and binding affinity properties of enantiomeric forms of DAU 5750, a novel M1-M3 muscari... Bioorg Med Chem. 1994 Dec;2(12):1375-83. | |||||
REF 66 | Doi: 10.1038/bjp.2008.208 | |||||
REF 67 | Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics. J Med Chem. 1989 Dec;32(12):2573-82. | |||||
REF 68 | Design and synthesis of a fluorescent muscarinic antagonist. Bioorg Med Chem Lett. 2008 Jan 15;18(2):825-7. | |||||
REF 69 | Nocardimicins A, B, C, D, E, and F, siderophores with muscarinic M3 receptor inhibiting activity from Nocardia sp. TP-A0674. J Nat Prod. 2005 Jul;68(7):1061-5. | |||||
REF 70 | Allosteric interactions of staurosporine and other indolocarbazoles with N-[methyl-(3)H]scopolamine and acetylcholine at muscarinic receptor subtypes: identification of a second allosteric site. Mol Pharmacol. 2000 Jul;58(1):194-207. | |||||
REF 71 | Binding of the labelled muscarinic toxin 125I-MT1 to rat brain muscarinic M1 receptors. Eur J Pharmacol. 1996 Jun 3;305(1-3):187-92. | |||||
REF 72 | Antagonist binding properties of five cloned muscarinic receptors expressed in CHO-K1 cells. Mol Pharmacol. 1989 Apr;35(4):469-76. | |||||
REF 73 | Chloro-substituted, sterically hindered 5,11-dicarbo analogues of clozapine as potential chiral antipsychotic agents. J Med Chem. 1990 Feb;33(2):809-14. | |||||
REF 74 | Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6. | |||||
REF 75 | Lithocholylcholine, a bile acid/acetylcholine hybrid, is a muscarinic receptor antagonist. J Pharmacol Exp Ther. 2002 Oct;303(1):29-35. | |||||
REF 76 | Human muscarinic receptors expressed in A9L and CHO cells: activation by full and partial agonists. Br J Pharmacol. 1995 Mar;114(6):1241-9. | |||||
REF 77 | Discovery, synthesis and characterization of a highly muscarinic acetylcholine receptor (mAChR)-selective M5-orthosteric antagonist, VU0488130 (ML381): a novel molecular probe. ChemMedChem. 2014 Aug;9(8):1677-82. | |||||
REF 78 | Synthesis and pharmacological evaluation of dimeric muscarinic acetylcholine receptor agonists. J Pharmacol Exp Ther. 2001 Sep;298(3):1260-8. | |||||
REF 79 | Which muscarinic receptor is important in the bladder World J Urol. 2001 Nov;19(5):299-306. | |||||
REF 80 | Generation of an agonistic binding site for blockers of the M(3) muscarinic acetylcholine receptor. Biochem J. 2008 May 15;412(1):103-12. | |||||
REF 81 | Stimulation of cyclic AMP accumulation and phosphoinositide hydrolysis by M3 muscarinic receptors in the rat peripheral lung. Biochem Pharmacol. 1996 Aug 23;52(4):643-58. | |||||
REF 82 | Heterocyclic muscarinic agonists. Synthesis and biological activity of some bicyclic sulfonium arecoline bioisosteres. J Med Chem. 1988 Jul;31(7):1312-6. | |||||
REF 83 | Thiochrome enhances acetylcholine affinity at muscarinic M4 receptors: receptor subtype selectivity via cooperativity rather than affinity. Mol Pharmacol. 2004 Jan;65(1):257-66. | |||||
REF 84 | Design, synthesis, and biological evaluation of pirenzepine analogs bearing a 1,2-cyclohexanediamine and perhydroquinoxaline units in exchange for the piperazine ring as antimuscarinics. Bioorg Med Chem. 2008 Aug 1;16(15):7311-20. | |||||
REF 85 | Dual M3 antagonists-PDE4 inhibitors. Part 2: Synthesis and SAR of 3-substituted azetidinyl derivatives. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3077-80. | |||||
REF 86 | Comparison of the in vitro and in vivo profiles of tolterodine with those of subtype-selective muscarinic receptor antagonists. Eur J Pharmacol. 1998 May 22;349(2-3):285-92. | |||||
REF 87 | A novel selective muscarinic acetylcholine receptor subtype 1 antagonist reduces seizures without impairing hippocampus-dependent learning. Mol Pharmacol. 2009 Aug;76(2):356-68. | |||||
REF 88 | Analogs of WIN 62,577 define a second allosteric site on muscarinic receptors. Mol Pharmacol. 2002 Dec;62(6):1492-505. | |||||
REF 89 | Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors. EMBO J. 1987 Dec 20;6(13):3923-9. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.