Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T69375
(Former ID: TTDR00334)
|
|||||
Target Name |
Stress-activated protein kinase JNK2 (JNK2)
|
|||||
Synonyms |
Stress-activated protein kinase 1a; SAPK1a; PRKM9; Mitogen-activated protein kinase 9; Mitogen-activated protein kinase 8-interacting protein 2; MAPK 9; MAP kinase 9; Jun-N-terminal kinase 2; JNK-interacting protein 2; JNK-55; JNK MAP kinase scaffold protein 2; JIP-2; Islet-brain-2; IB-2; C-jun-amino-terminal kinase interacting protein 2; C-Jun N-terminal kinase 2
|
|||||
Gene Name |
MAPK9
|
|||||
Target Type |
Preclinical target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Mature T-cell lymphoma [ICD-11: 2A90] | |||||
Function |
Extracellular stimuli such as proinflammatory cytokines or physical stress stimulate the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. In this cascade, two dual specificity kinases MAP2K4/MKK4 and MAP2K7/MKK7 phosphorylate and activate MAPK9/JNK2. In turn, MAPK9/JNK2 phosphorylates a number of transcription factors, primarily components of AP-1 such as JUN and ATF2 and thus regulates AP-1 transcriptional activity. In response to oxidative or ribotoxic stresses, inhibits rRNA synthesis by phosphorylating and inactivating the RNA polymerase 1-specific transcription initiation factor RRN3. Promotes stressed cell apoptosis by phosphorylating key regulatory factors including TP53 and YAP1. In T-cells, MAPK8 and MAPK9 are required for polarized differentiation of T-helper cells into Th1 cells. Upon T-cell receptor (TCR) stimulation, is activated by CARMA1, BCL10, MAP2K7 and MAP3K7/TAK1 to regulate JUN protein levels. Plays an important role in the osmotic stress-induced epithelial tight-junctions disruption. When activated, promotes beta-catenin/CTNNB1 degradation and inhibits the canonical Wnt signaling pathway. Participates also in neurite growth in spiral ganglion neurons. Phosphorylates the CLOCK-ARNTL/BMAL1 heterodimer and plays a role in the regulation of the circadian clock. Phosphorylates POU5F1, which results in the inhibition of POU5F1's transcriptional activity and enhances its proteosomal degradation. Serine/threonine-protein kinase involved in various processes such as cell proliferation, differentiation, migration, transformation and programmed cell death.
Click to Show/Hide
|
|||||
BioChemical Class |
Kinase
|
|||||
UniProt ID | ||||||
EC Number |
EC 2.7.11.24
|
|||||
Sequence |
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL EGCR Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T39WPZ |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | COR-D | Drug Info | Preclinical | T-cell leukaemia | [2] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 27 Inhibitor drugs | + | ||||
1 | 7-azaindole derivative 1 | Drug Info | [1] | |||
2 | 7-azaindole derivative 2 | Drug Info | [1] | |||
3 | 7-azaindole derivative 3 | Drug Info | [1] | |||
4 | 7-azaindole derivative 5 | Drug Info | [1] | |||
5 | PMID25991433-Compound-A1 | Drug Info | [1] | |||
6 | PMID25991433-Compound-A10 | Drug Info | [1] | |||
7 | PMID25991433-Compound-A11 | Drug Info | [1] | |||
8 | PMID25991433-Compound-A2 | Drug Info | [1] | |||
9 | PMID25991433-Compound-A3 | Drug Info | [1] | |||
10 | PMID25991433-Compound-A5 | Drug Info | [1] | |||
11 | PMID25991433-Compound-A6 | Drug Info | [1] | |||
12 | PMID25991433-Compound-A7 | Drug Info | [1] | |||
13 | PMID25991433-Compound-A8 | Drug Info | [1] | |||
14 | PMID25991433-Compound-A9 | Drug Info | [1] | |||
15 | PMID25991433-Compound-C1 | Drug Info | [1] | |||
16 | PMID25991433-Compound-D1 | Drug Info | [1] | |||
17 | PMID25991433-Compound-D2 | Drug Info | [1] | |||
18 | PMID25991433-Compound-F2 | Drug Info | [1] | |||
19 | PMID25991433-Compound-J2 | Drug Info | [1] | |||
20 | PMID25991433-Compound-J3 | Drug Info | [1] | |||
21 | PMID25991433-Compound-J5 | Drug Info | [1] | |||
22 | PMID25991433-Compound-O3 | Drug Info | [1] | |||
23 | PMID25991433-Compound-P1 | Drug Info | [1] | |||
24 | PMID25991433-Compound-P4 | Drug Info | [1] | |||
25 | PMID25991433-Compound-P5 | Drug Info | [1] | |||
26 | PMID25991433-Compound-P6 | Drug Info | [1] | |||
27 | 2,6-Dihydroanthra/1,9-Cd/Pyrazol-6-One | Drug Info | [4] | |||
Activator | [+] 1 Activator drugs | + | ||||
1 | COR-D | Drug Info | [3] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | c-Jun N-terminal kinase inhibitors: a patent review (2010 - 2014).Expert Opin Ther Pat. 2015;25(8):849-72. | |||||
REF 2 | ClinicalTrials.gov (NCT04022863) Ovarium Cancer Detection by TEP's and ctDNA. U.S. National Institutes of Health. | |||||
REF 3 | Corchorusin-D directed apoptosis of K562 cells occurs through activation of mitochondrial and death receptor pathways and suppression of AKT/PKB pathway. Cell Physiol Biochem. 2012;30(4):915-26. | |||||
REF 4 | Pharmacological inhibitors of MAPK pathways. Trends Pharmacol Sci. 2002 Jan;23(1):40-5. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.