Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T13017
(Former ID: TTDI02170)
|
|||||
| Target Name |
Syndecan-1 (SDC1)
|
|||||
| Synonyms |
SYND1; SDC; CD138
|
|||||
| Gene Name |
SDC1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Immune system disease [ICD-11: 4A01-4B41] | |||||
| 2 | Multiple myeloma [ICD-11: 2A83] | |||||
| Function |
Regulates exosome biogenesis in concert with SDCBP and PDCD6IP. Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix.
Click to Show/Hide
|
|||||
| BioChemical Class |
Peptide translocating syndecan
|
|||||
| UniProt ID | ||||||
| Sequence |
MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ KPTKQEEFYA Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 6 Clinical Trial Drugs | + | ||||
| 1 | BT-062 | Drug Info | Phase 2 | Multiple myeloma | [2], [3] | |
| 2 | CART-138 cells | Drug Info | Phase 1/2 | Multiple myeloma | [4] | |
| 3 | CART-138 cells | Drug Info | Phase 1/2 | Multiple myeloma | [5] | |
| 4 | CD138 CAR T cells | Drug Info | Phase 1/2 | Multiple myeloma | [6] | |
| 5 | CAR138 T Cells | Drug Info | Phase 1 | Immune System disease | [7] | |
| 6 | CAR-T cells targeting CD138 | Drug Info | Clinical trial | Multiple myeloma | [8] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| CAR-T-Cell-Therapy | [+] 5 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | CART-138 cells | Drug Info | [4] | |||
| 2 | CART-138 cells | Drug Info | [5] | |||
| 3 | CD138 CAR T cells | Drug Info | [6] | |||
| 4 | CAR138 T Cells | Drug Info | [7] | |||
| 5 | CAR-T cells targeting CD138 | Drug Info | [8] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| PID Pathway | [+] 5 PID Pathways | + | ||||
| 1 | Beta3 integrin cell surface interactions | |||||
| 2 | Integrins in angiogenesis | |||||
| 3 | Proteoglycan syndecan-mediated signaling events | |||||
| 4 | Syndecan-1-mediated signaling events | |||||
| 5 | Beta5 beta6 beta7 and beta8 integrin cell surface interactions | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | The monoclonal antibody nBT062 conjugated to cytotoxic Maytansinoids has selective cytotoxicity against CD138-positive multiple myeloma cells in vitro and in vivo. Clin Cancer Res. 2009 Jun 15;15(12):4028-37. | |||||
| REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 4 | ClinicalTrials.gov (NCT01886976) Treatment of Chemotherapy Refractory Multiple Myeloma by CART-138 | |||||
| REF 5 | ClinicalTrials.gov (NCT03196414) Study of CART-138/BCMA Therapy for R/R Multiple Myeloma | |||||
| REF 6 | ClinicalTrials.gov (NCT03271632) Multi-CAR T Cell Therapy in the Treatment of Multiple Myeloma | |||||
| REF 7 | ClinicalTrials.gov (NCT03672318) Study of ATLCAR.CD138 Cells for Relapsed/Refractory Multiple Myeloma | |||||
| REF 8 | ClinicalTrials.gov (NCT03473496) CAR-T Cells Therapy in Relapsed/Refractory Multiple Myeloma | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.