Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T13644
(Former ID: TTDC00254)
|
|||||
Target Name |
Somatostatin receptor type 3 (SSTR3)
|
|||||
Synonyms |
SSTR3; SSR-28; SS3R
|
|||||
Gene Name |
SSTR3
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Cushing syndrome [ICD-11: 5A70] | |||||
Function |
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Pasireotide | Drug Info | Approved | Cushing disease | [2], [3] | |
Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
1 | FR-121196 | Drug Info | Terminated | Alzheimer disease | [4] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Inhibitor | [+] 21 Inhibitor drugs | + | ||||
1 | Pasireotide | Drug Info | [1] | |||
2 | ODT-8 | Drug Info | [5] | |||
3 | Cytotoxin Peptide Conjugate | Drug Info | [10] | |||
4 | Des-AA1,2,4,12,13-[D-Trp8]SRIF | Drug Info | [5] | |||
5 | Des-AA1,2,4,13-[D-Trp8]SRIF | Drug Info | [5] | |||
6 | Des-AA1,2,4,5,10,12,13-[D-Trp8]SRIF | Drug Info | [5] | |||
7 | Des-AA1,2,4,5,13-[D-Trp8]-SRIF | Drug Info | [5] | |||
8 | Des-AA1,2,4,5-[D-Trp8]SRIF | Drug Info | [5] | |||
9 | Des-AA1,2,5,12,13-[D-Trp8,IAmp9]SRIF | Drug Info | [5] | |||
10 | Des-AA1,2,5,12,13-[D-Trp8]SRIF | Drug Info | [5] | |||
11 | Des-AA1,2,5-[D-Trp8,(NalphaMe)IAmp9]SRIF | Drug Info | [11] | |||
12 | Des-AA1,2,5-[D-Trp8,IAmp9,m-I-Tyr11]Cbm-SRIF | Drug Info | [11] | |||
13 | Des-AA1,2,5-[D-Trp8,IAmp9]SRIF CH-275 | Drug Info | [11] | |||
14 | Des-AA1,2,5-[D-Trp8,Tyr11]SRIF | Drug Info | [11] | |||
15 | Des-AA1,4,5,13-[Tyr2,D-Trp8]-SRIF | Drug Info | [5] | |||
16 | Des-AA1,5-[Tyr2,D-Trp8,IAmp9]Cbm-SRIF | Drug Info | [11] | |||
17 | Des-AA5-[D-Trp8]SRIF | Drug Info | [11] | |||
18 | H-D-Phe-c[Cys-Ala-D-Trp-Lys-Thr-Cys]-Thr-NH2 | Drug Info | [12] | |||
19 | H-DPhe-c[Cys-Phe-DTrp-Lys-Thr-Cys]-Thr-NH2 | Drug Info | [12] | |||
20 | SOMATOSTATIN | Drug Info | [14] | |||
21 | SRIF-28 | Drug Info | [16] | |||
Modulator | [+] 2 Modulator drugs | + | ||||
1 | FR-121196 | Drug Info | [6], [7] | |||
2 | 99mTc-MIP-1407 | Drug Info | [6], [7] | |||
Agonist | [+] 5 Agonist drugs | + | ||||
1 | BN-81,644 | Drug Info | [8] | |||
2 | BN-81,674 | Drug Info | [8] | |||
3 | CGP 23996 | Drug Info | [9] | |||
4 | L-796,778 | Drug Info | [13] | |||
5 | SRIF-14 | Drug Info | [15] | |||
Antagonist | [+] 1 Antagonist drugs | + | ||||
1 | NVP ACQ090 | Drug Info | [1] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | Neuroactive ligand-receptor interaction | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Peptide ligand-binding receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | GPCRs, Class A Rhodopsin-like | |||||
2 | Peptide GPCRs | |||||
3 | GPCR ligand binding | |||||
4 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 357). | |||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 3 | ClinicalTrials.gov (NCT02527993) Treatment of Hypoglycemia Following Gastric Bypass Surgery. | |||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001380) | |||||
REF 5 | Somatostatin receptor 1 selective analogues: 3. Dicyclic peptides. J Med Chem. 2005 Jan 27;48(2):515-22. | |||||
REF 6 | Nat Rev Drug Discov. 2013 Feb;12(2):87-90. | |||||
REF 7 | Pasireotide and octreotide stimulate distinct patterns of sst2A somatostatin receptor phosphorylation. Mol Endocrinol. 2010 Feb;24(2):436-46. | |||||
REF 8 | Identification of potent non-peptide somatostatin antagonists with sst(3) selectivity. J Med Chem. 2001 Aug 30;44(18):2990-3000. | |||||
REF 9 | Characterisation of human recombinant somatostatin receptors. 1. Radioligand binding studies. Naunyn Schmiedebergs Arch Pharmacol. 1999 Nov;360(5):488-99. | |||||
REF 10 | An adjustable release rate linking strategy for cytotoxin-peptide conjugates. Bioorg Med Chem Lett. 2003 Mar 10;13(5):799-803. | |||||
REF 11 | Somatostatin receptor 1 selective analogues: 2. N(alpha)-Methylated scan. J Med Chem. 2005 Jan 27;48(2):507-14. | |||||
REF 12 | Novel sst2-selective somatostatin agonists. Three-dimensional consensus structure by NMR. J Med Chem. 2006 Jul 27;49(15):4487-96. | |||||
REF 13 | Rapid identification of subtype-selective agonists of the somatostatin receptor through combinatorial chemistry. Science. 1998 Oct 23;282(5389):737-40. | |||||
REF 14 | Discovery of iodinated somatostatin analogues selective for hsst2 and hsst5 with excellent inhibition of growth hormone and prolactin release from ... J Med Chem. 2005 Oct 20;48(21):6643-52. | |||||
REF 15 | A human somatostatin receptor (SSTR3), located on chromosome 22, displays preferential affinity for somatostatin-14 like peptides. FEBS Lett. 1993 Apr 26;321(2-3):279-84. | |||||
REF 16 | Novel octreotide dicarba-analogues with high affinity and different selectivity for somatostatin receptors. J Med Chem. 2010 Aug 26;53(16):6188-97. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.