Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T17427
(Former ID: TTDI02083)
|
|||||
| Target Name |
Platelet glycoprotein Ib alpha (CD42b)
|
|||||
| Synonyms |
Platelet glycoprotein Ib alpha chain; Glycoprotein Ibalpha; Glycocalicin; GPIbalpha; GPIbA; GPIb-alpha; GPIb alpha; GP-Ib alpha; Antigen CD42balpha; Antigen CD42b-alpha
|
|||||
| Gene Name |
GP1BA
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Thrombosis [ICD-11: DB61-GB90] | |||||
| Function |
GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLY
TFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTV LDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELP AGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNA ENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDT EGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWT PNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPS PTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSTFLT TTKPVSLLESTKKTIPELDQPPKLRGVLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLFW LLFASVVLILLLSWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRG SLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | ZK-001 | Drug Info | Phase 1/2 | Thrombosis | [1] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | TGX-6B4 | Drug Info | Preclinical | Thrombosis | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | ZK-001 | Drug Info | [1] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
| 1 | ECM-receptor interaction | |||||
| 2 | Platelet activation | |||||
| 3 | Hematopoietic cell lineage | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | Blood coagulation | |||||
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | Beta2 integrin cell surface interactions | |||||
| Reactome | [+] 3 Reactome Pathways | + | ||||
| 1 | Intrinsic Pathway of Fibrin Clot Formation | |||||
| 2 | GP1b-IX-V activation signalling | |||||
| 3 | Platelet Adhesion to exposed collagen | |||||
| WikiPathways | [+] 4 WikiPathways | + | ||||
| 1 | Platelet Aggregation (Plug Formation) | |||||
| 2 | Platelet Adhesion to exposed collagen | |||||
| 3 | GP1b-IX-V activation signalling | |||||
| 4 | Formation of Fibrin Clot (Clotting Cascade) | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Anfibatide, a novel GPIb complex antagonist, inhibits platelet adhesion and thrombus formation in vitro and in vivo in murine models of thrombosis. Thromb Haemost. 2014 Feb;111(2):279-89. | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015808) | |||||
| REF 3 | Antithrombotic effect of platelet glycoprotein Ib-blocking monoclonal antibody Fab fragments in nonhuman primates. Arterioscler Thromb Vasc Biol. 2000 May;20(5):1347-53. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.