Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T31230
(Former ID: TTDS00307)
|
|||||
| Target Name |
Bacterial Fumarate reductase flavoprotein (Bact frdA)
|
|||||
| Synonyms |
Fumarate reductase; FRDA
Click to Show/Hide
|
|||||
| Gene Name |
Bact frdA
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 4 Target-related Diseases | + | ||||
| 1 | Hydrocephalus [ICD-11: 8D64] | |||||
| 2 | Nematode disease [ICD-11: 1F6Y] | |||||
| 3 | Parasitic worm infestation [ICD-11: 1F90] | |||||
| 4 | Trichuriasis [ICD-11: 1F6G] | |||||
| Function |
Two distinct, membrane-bound, fad-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; The fumarate reductase is used in anaerobic growth, and the succinate dehydrogenase is used in aerobic growth.
Click to Show/Hide
|
|||||
| BioChemical Class |
CH-CH donor oxidoreductase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 1.3.5.4
|
|||||
| Sequence |
MKITYCDALIIGGGLAGLRASIACKQKGLNTIVLSLVPVRRSHSAAAQGGMQASLANAKK
SEGDNEDLHFLDTVKGSDWGCDQQVARMFVTTAPKAIRELASWGVPWTRIKKGDRPAVVN GEHVTITERDDRHGYILSRDFGGTKKWRTCFTADATGHTMLYAVANEALHHKVDIQDRKD MLAFIHHDNKCYGAVVRDLITGEISAYVSKGTLLATGGYGRVYKHTTNAVICDGAGAASA LETGVAKLGNMEAVQFHPTALVPSGILMTEGCRGDGGVLRDKFGRRFMPAYEPEKKELAS RDVVSRRILEHIQKGYGAKSPYGDHVWLDIAILGRNHVEKNLRDVRDIAMTFAGIDPADS KEQTKDNMQGVPANEPEYGQAMAKQKGWIPIKPMQHYSMGGVRTNPKGETHLKGLFCAGE AACWDLHGFNRLGGNSVSEAVVAGMIIGDYFASHCLEAQIEINTQKVEAFIKESQDYMHF LLHNEGKEDVYEIRERMKEVMDEKVGVFREGKRLEEALKELQELYARSKNICVKNKVLHN NPELEDAYRTKKMLKLALCITQGALLRTESRGAHTRIDYPKRDDEKWLNRTLASWPSAEQ DMPTIEYEELDVMKMEISPDFRGYGKKGNFIPHPKKEERDAEILKTILELEKLGKDRIEV QHALMPFELQEKYKARNMRLEDEEVRARGEHLYSFNVHELLDQHNANLKGEHHE Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 3 Approved Drugs | + | ||||
| 1 | Morantel tartrate | Drug Info | Approved | Mature gastrointestinal nematode infection | [2] | |
| 2 | Oxantel pamoate | Drug Info | Approved | Trichuris trichiura infection | [1] | |
| 3 | Thiabendazole | Drug Info | Approved | Helminth infection | [3], [4], [5] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 11 Inhibitor drugs | + | ||||
| 1 | Morantel tartrate | Drug Info | [1], [6] | |||
| 2 | Oxantel pamoate | Drug Info | [1] | |||
| 3 | Thiabendazole | Drug Info | [1] | |||
| 4 | 2,3-DIMETHYL-1,4-NAPHTHOQUINONE | Drug Info | [7] | |||
| 5 | 2-HEPTYL-4-HYDROXY QUINOLINE N-OXIDE | Drug Info | [7] | |||
| 6 | 2-[1-(4-CHLORO-PHENYL)-ETHYL]-4,6-DINITRO-PHENOL | Drug Info | [7] | |||
| 7 | Citraconic acid | Drug Info | [8] | |||
| 8 | Flavin-Adenine Dinucleotide | Drug Info | [9] | |||
| 9 | Fumarate | Drug Info | [9] | |||
| 10 | Heme | Drug Info | [7] | |||
| 11 | Malate Like Intermediate | Drug Info | [8] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Fumarate reductase is essential for Helicobacter pylori colonization of the mouse stomach. Microb Pathog. 2000 Nov;29(5):279-87. | |||||
| REF 2 | Morantel tartrate. Canadian Food Inspection Agency. Government of Canada. 2010-08. | |||||
| REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7304). | |||||
| REF 4 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016096. | |||||
| REF 5 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 6 | Fumarate reductase: a target for therapeutic intervention against Helicobacter pylori. Arch Biochem Biophys. 1995 Aug 1;321(1):153-9. | |||||
| REF 7 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 8 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41. | |||||
| REF 9 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.