Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T39855
(Former ID: TTDR00667)
|
|||||
Target Name |
Melanoma differentiation-associated protein 6 (CDKN1A)
|
|||||
Synonyms |
WAF1; SDI1; PIC1; P21(WAF1); P21; Melanoma differentiation associated protein 6; MDA6; MDA-6; Cyclin-dependent kinase inhibitor 1; CIP1; CDK-interacting protein 1; CAP20
|
|||||
Gene Name |
CDKN1A
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Binds to and inhibits cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. Functions in the nuclear localization and assembly of cyclin D-CDK4 complex and promotes its kinase activity towards RB1. At higher stoichiometric ratios, inhibits the kinase activity of the cyclin D-CDK4 complex. Inhibits DNA synthesis by DNA polymerase delta by competing with POLD3 for PCNA binding. May be involved in p53/TP53 mediated inhibition of cellular proliferation in response to DNA damage.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A08298 | |||||
HIT2.0 ID | T64W2K |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | p21(WAF1) Gene Transfection Inhibits Proliferation of Leukemia Cell Line K562 Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2001 Jun;9(2):115-118. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.