Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T49639
(Former ID: TTDR00169)
|
|||||
Target Name |
Heat shock protein 70 (HSP70)
|
|||||
Synonyms |
Heat shock 70 kDa protein; HSP72; HSP70
Click to Show/Hide
|
|||||
Gene Name |
HSPA1A; HSPA1B
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 8 Target-related Diseases | + | ||||
1 | Leukaemia [ICD-11: 2A60-2B33] | |||||
2 | Neuropathy [ICD-11: 8C0Z] | |||||
3 | Diabetic foot ulcer [ICD-11: BD54] | |||||
4 | Herpes simplex infection [ICD-11: 1F00] | |||||
5 | Malignant digestive organ neoplasm [ICD-11: 2C11] | |||||
6 | Metastatic malignant neoplasm [ICD-11: 2D50-2E09] | |||||
7 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
8 | Stomach cancer [ICD-11: 2B72] | |||||
Function |
In unstressed cells, is present in a HSP90-containing multichaperone complex that maintains it in a non-DNA-binding inactivated monomeric form. Upon exposure to heat and other stress stimuli, undergoes homotrimerization and activates HSP gene transcription through binding to site-specific heat shock elements (HSEs) present in the promoter regions of HSP genes. Activation is reversible, and during the attenuation and recovery phase period of the HSR, returns to its unactivated form. Binds to inverted 5'-NGAAN-3' pentamer DNA sequences. Binds to chromatin at heat shock gene promoters. Plays also several other functions independently of its transcriptional activity. Involved in the repression of Ras-induced transcriptional activation of the c-fos gene in heat-stressed cells. Positively regulates pre-mRNA 3'-end processing and polyadenylation of HSP70 mRNA upon heat-stressed cells in a symplekin (SYMPK)-dependent manner. Plays a role in nuclear export of stress-induced HSP70 mRNA. Plays a role in the regulation of mitotic progression. Plays also a role as a negative regulator of non-homologous end joining (NHEJ) repair activity in a DNA damage-dependent manner. Involved in stress-induced cancer cell proliferation in a IER5-dependent manner. Function as a stress-inducible and DNA-binding transcription factor that plays a central role in the transcriptional activation of the heat shock response (HSR), leading to the expression of a large class of molecular chaperones heat shock proteins (HSPs) that protect cells from cellular insults' damage.
Click to Show/Hide
|
|||||
BioChemical Class |
Heat shock protein
|
|||||
UniProt ID | ||||||
Sequence |
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 8 Clinical Trial Drugs | + | ||||
1 | AEG-33773 | Drug Info | Phase 2 | Diabetic neuropathy | [2] | |
2 | AG-858 | Drug Info | Phase 2 | leukaemia | [3] | |
3 | AG-707 | Drug Info | Phase 1 | Herpes simplex virus infection | [4] | |
4 | BRX-005 | Drug Info | Phase 1 | Diabetic foot ulcer | [5] | |
5 | Enkastim-ev | Drug Info | Phase 1 | Solid tumour/cancer | [6] | |
6 | H-103 | Drug Info | Phase 1 | Metastatic malignant neoplasm | [7] | |
7 | Minnelide | Drug Info | Phase 1 | Solid tumour/cancer | [8] | |
8 | Minnelide 001 | Drug Info | Phase 1 | Gastrointestinal cancer | [9] | |
Discontinued Drug(s) | [+] 2 Discontinued Drugs | + | ||||
1 | Bimoclomol | Drug Info | Discontinued in Phase 2 | Diabetic complication | [10] | |
2 | NK-1001 | Drug Info | Discontinued in Phase 2 | Atrial fibrillation | [11] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 6 Inhibitor drugs | + | ||||
1 | AEG-33773 | Drug Info | [1] | |||
2 | Minnelide | Drug Info | [8] | |||
3 | ELLAGIC ACID | Drug Info | [20] | |||
4 | NSC-119910 | Drug Info | [20] | |||
5 | NSC-119911 | Drug Info | [20] | |||
6 | NSC-119913 | Drug Info | [20] | |||
Modulator | [+] 7 Modulator drugs | + | ||||
1 | AG-707 | Drug Info | [13] | |||
2 | BRX-005 | Drug Info | [14] | |||
3 | Enkastim-ev | Drug Info | [15] | |||
4 | H-103 | Drug Info | [7] | |||
5 | Minnelide 001 | Drug Info | [16] | |||
6 | Bimoclomol | Drug Info | [17], [18] | |||
7 | NK-1001 | Drug Info | [19] |
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Mitogen-activated protein kinase kinase kinase 12 (MAP3K12; DLK); c-jun N-terminal kinase (JNK). SciBX 2(11); doi:10.1038/scibx.2009.462. March 19 2009 | |||||
REF 2 | ClinicalTrials.gov (NCT00891683) Safety and Efficacy of AEG33773 Versus Placebo in Patients With Painful Diabetic Peripheral Neuropathy. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT00058747) AG-858 in Patients Who Are Cytogenetically Positive After Treatment With Gleevec . U.S. National Institutes of Health. | |||||
REF 4 | ClinicalTrials.gov (NCT00231049) Trial Evaluating Safety, Tolerability and Immune Response of AG-707. U.S. National Institutes of Health. | |||||
REF 5 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013054) | |||||
REF 6 | Clinical pipeline report, company report or official report of Multimmune GmbH. | |||||
REF 7 | A phase I trial of intratumoral administration of recombinant oncolytic adenovirus overexpressing HSP70 in advanced solid tumor patients. Gene Ther. 2009 Mar;16(3):376-82. | |||||
REF 8 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 9 | ClinicalTrials.gov (NCT01927965) Study of Minnelide in Patients With Advanced GI Tumors. U.S. National Institutes of Health. | |||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004241) | |||||
REF 11 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033456) | |||||
REF 12 | Preparation of a Heat Shock Proteins 70-based Vaccine from DC-tumor fusion cells. Methods Mol Biol. 2011; 787: 255-265. | |||||
REF 13 | A heat shock protein based polyvalent vaccine targeting HSV-2: CD4(+) and CD8(+) cellular immunity and protective efficacy. Vaccine. 2011 Nov 3;29(47):8530-41. | |||||
REF 14 | Cardiovascular effects of BRX-005 comparison to bimoclomol. Life Sci. 2000 Aug 25;67(14):1783-9. | |||||
REF 15 | Company report (Multimmune) | |||||
REF 16 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
REF 17 | Bimoclomol elevates heat shock protein 70 and cytoprotects rat neonatal cardiomyocytes. Eur J Pharmacol. 2002 Jan 18;435(1):73-7. | |||||
REF 18 | Oral bimoclomol elevates heat shock protein 70 and reduces myocardial infarct size in rats. Eur J Pharmacol. 2002 Jan 18;435(1):79-83. | |||||
REF 19 | Novel therapeutic targets in the management of atrial fibrillation. Am J Cardiovasc Drugs. 2014 Dec;14(6):403-21. | |||||
REF 20 | In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.