Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T58238
(Former ID: TTDS00453)
|
|||||
| Target Name |
Activation B7-1 antigen (CD80)
|
|||||
| Synonyms |
T-lymphocyte activation antigen CD80; LAB7; CTLA-4 counter-receptor B7.1; CD28LG1; CD28LG; BB1; B7
|
|||||
| Gene Name |
CD80
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Rheumatoid arthritis [ICD-11: FA20] | |||||
| Function |
T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation. Involved in the costimulatory signal essential for T-lymphocyte activation.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A02356 | |||||
| HIT2.0 ID | T23OTN | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Abatacept | Drug Info | Approved | Rheumatoid arthritis | [2], [3], [4] | |
| Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
| 1 | RhuDex | Drug Info | Phase 2a | Rheumatoid arthritis | [5] | |
| 2 | Galiximab | Drug Info | Phase 2 | Lymphoma | [6] | |
| 3 | HS-110 | Drug Info | Phase 2 | Non-small-cell lung cancer | [7] | |
| 4 | CAR-T cells targeting CD80/86 | Drug Info | Phase 1 | Solid tumour/cancer | [8] | |
| 5 | MAXY-4 | Drug Info | Phase 1 | Autoimmune diabetes | [9] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Tolerimab | Drug Info | Terminated | Transplant rejection | [10] | |
| Mode of Action | [+] 3 Modes of Action | + | ||||
| Binder | [+] 1 Binder drugs | + | ||||
| 1 | Abatacept | Drug Info | [1] | |||
| Inhibitor | [+] 2 Inhibitor drugs | + | ||||
| 1 | RhuDex | Drug Info | [11] | |||
| 2 | MAXY-4 | Drug Info | [14] | |||
| CAR-T-Cell-Therapy | [+] 1 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | CAR-T cells targeting CD80/86 | Drug Info | [8] | |||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Selective modulation of T-cell co-stimulation: a novel mode of action for the treatment of rheumatoid arthritis. Clin Exp Rheumatol. 2009 May-Jun;27(3):510-8. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6891). | |||||
| REF 3 | Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54. | |||||
| REF 4 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 5 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | |||||
| REF 6 | ClinicalTrials.gov (NCT00516217) Galiximab in Treating Patients With Relapsed or Refractory Hodgkin's Lymphoma. U.S. National Institutes of Health. | |||||
| REF 7 | ClinicalTrials.gov (NCT02117024) A Phase 2 Study of Viagenpumatucel-L (HS-110) in Patients With Non-Small Cell Lung Cancer. U.S. National Institutes of Health. | |||||
| REF 8 | ClinicalTrials.gov (NCT03198052) HER2/Mesothelin/Lewis-Y/PSCA/MUC1/PD-L1/CD80/86-CAR-T Cells Immunotherapy Against Cancers | |||||
| REF 9 | ClinicalTrials.gov (NCT02052375) A Study To Evaluate the Pharmacokinetics, Pharmacodynamics, Safety and Tolerability of ASP2408 After Multiple Dose Subcutaneous Injections in Patients With RheumatoidArthritis on Methotrexate. U.S. National Institutes of Health. | |||||
| REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011393) | |||||
| REF 11 | A phase 1 study of AS1409, a novel antibody-cytokine fusion protein, in patients with malignant melanoma or renal cell carcinoma. Clin Cancer Res. 2011 Apr 1;17(7):1998-2005. | |||||
| REF 12 | Phase I/II study of galiximab, an anti-CD80 antibody, for relapsed or refractory follicular lymphoma. J Clin Oncol. 2005 Jul 1;23(19):4390-8. | |||||
| REF 13 | Clinical pipeline report, company report or official report of Heat Biologics. | |||||
| REF 14 | Trans-endocytosis of CD80 and CD86: a molecular basis for the cell-extrinsic function of CTLA-4. Science. 2011 Apr 29;332(6029):600-3. | |||||
| REF 15 | US patent application no. 2004,0171,123, Albumin fusion proteins. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.