Target Information

Target General Information

Top

Target ID

T75570 (Former ID: TTDS00408)

Target Name

Yes tyrosine kinase (YES)

Synonyms

p61-Yes; Yes p59-Fyn; Yes Protooncogene Syn; Tyrosine-protein kinase Yes; Proto-oncogene c-Yes

Click to Show/Hide

Gene Name

YES1

Target Type

Clinical trial target

[1]

Disease

[+] 1 Target-related Diseases

Solid tumour/cancer [ICD-11: 2A00-2F9Z]

Function

Stimulation by receptor tyrosine kinases (RTKs) including EGRF, PDGFR, CSF1R and FGFR leads to recruitment of YES1 to the phosphorylated receptor, and activation and phosphorylation of downstream substrates. Upon EGFR activation, promotes the phosphorylation of PARD3 to favor epithelial tight junction assembly. Participates in the phosphorylation of specific junctional components such as CTNND1 by stimulating the FYN and FER tyrosine kinases at cell-cell contacts. Upon T-cell stimulation by CXCL12, phosphorylates collapsin response mediator protein 2/DPYSL2 and induces T-cell migration. Participates in CD95L/FASLG signaling pathway and mediates AKT-mediated cell migration. Plays a role in cell cycle progression by phosphorylating the cyclin-dependent kinase 4/CDK4 thus regulating the G1 phase. Also involved in G2/M progression and cytokinesis. Non-receptor protein tyrosine kinase that is involved in the regulation of cell growth and survival, apoptosis, cell-cell adhesion, cytoskeleton remodeling, and differentiation.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

YES_HUMAN

EC Number

EC 2.7.10.2

Sequence

MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 1 Clinical Trial Drugs

JNJ-26483327

Drug Info

Phase 1

Solid tumour/cancer

[2]

Mode of Action

[+] 1 Modes of Action

Inhibitor

[+] 2 Inhibitor drugs

JNJ-26483327

Drug Info

[1]

TG-100435

Drug Info

[3]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Tissue Distribution Human Pathway Affiliation Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Tissue Distribution

Human Pathway Affiliation

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Mixed lineage kinase 1 (MAP3K9)	PF00069 ; PF14604	35.439 (101/285)	5.57E-32
Serine/threonine-protein kinase 26 (STK26)	PF00069	30.800 (77/250)	5.49E-24
Oxidative stress responsive 1 (OXSR1)	PF12202 ; PF00069	28.322 (81/286)	7.82E-24
Ste-20-related kinase (STK39)	PF12202 ; PF00069	28.671 (82/286)	9.02E-24
Serine/threonine-protein kinase 24 (STK24)	PF00069	30.705 (74/241)	2.86E-23
Microtubule affinity regulating kinase 3 (MARK3)	PF02149 ; PF00069 ; PF00627 More >>	29.206 (92/315)	3.92E-23
Serine/threonine-protein kinase Nek5 (NEK5)	PF00069	26.378 (67/254)	4.12E-23
Serine/threonine-protein kinase 25 (STK25)	PF00069	29.876 (72/241)	1.08E-21
MAP/microtubule affinity-regulating kinase 4 (MARK4)	PF02149 ; PF00069 ; PF00627 More >>	31.086 (83/267)	2.89E-21
Serine/threonine-protein kinase MARK1 (MARK1)	PF02149 ; PF00069 ; PF00627 More >>	32.159 (73/227)	4.56E-21
Omphalocele kinase 1 (NUAK1)	PF00069	29.644 (75/253)	6.47E-21
Serine/threonine-protein kinase MARK2 (MARK2)	PF02149 ; PF00069 ; PF00627 More >>	31.716 (85/268)	2.36E-20
NIMA-related kinase 7 (NEK7)	PF00069	25.540 (71/278)	5.60E-20
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1)	PF16579 ; PF00069	29.658 (78/263)	1.21E-19
NIMA-related kinase 6 (NEK6)	PF00069	25.172 (73/290)	1.75E-19
Leucine-rich repeat kinase 2 (LRRK2)	PF16095 ; PF12799 ; PF13855 ; PF00069 ; PF08477 More >>	30.859 (79/256)	2.10E-19
Serine/threonine-protein kinase Nek11 (NEK11)	PF00069	27.600 (69/250)	2.54E-19
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2)	PF16579 ; PF00069	29.167 (77/264)	2.63E-19
Cyclin-dependent kinase 3 (CDK3)	PF00069	31.651 (69/218)	3.33E-19
Serine/threonine-protein kinase Nek4 (NEK4)	PF00069	29.268 (72/246)	6.01E-19
SPS1/STE20-related protein kinase YSK4 (YSK4)	PF00069	26.217 (70/267)	1.79E-18
Serine/threonine-protein kinase Nek3 (NEK3)	PF00069	25.820 (63/244)	1.82E-18
Polo-like kinase 2 (PLK2)	PF00069 ; PF00659	26.038 (69/265)	5.24E-18
Ribosomal protein S6 kinase alpha-3 (RSK3)	PF00069 ; PF00433	27.419 (68/248)	6.33E-18
Proto-oncogene serine/threonine-protein kinase mos (MOS)	PF00069	27.682 (80/289)	6.45E-18
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)	PF00069 ; PF12721	28.223 (81/287)	9.18E-18
Myosin light chain kinase 2 (MYLK2)	PF00069	31.364 (69/220)	1.04E-17
BR serine/threonine kinase 2 (BRSK2)	PF00069	29.845 (77/258)	1.25E-17
SIK family kinase 3 (SIK3)	PF00069	30.268 (79/261)	1.26E-17
NUAK family SNF1-like kinase 2 (NUAK2)	PF00069	29.200 (73/250)	1.38E-17
Salt-inducible kinase 2 (SIK2)	PF00069	29.880 (75/251)	1.41E-17
Cyclin-dependent kinase 5 (CDK5)	PF00069	29.545 (65/220)	1.59E-17
TRAF2 and NCK interacting kinase (TNIK)	PF00780 ; PF00069	26.316 (70/266)	1.64E-17
Cyclin-dependent kinase 13 (CDK13)	PF12330 ; PF00069	28.631 (69/241)	2.48E-17
MAP kinase p38 (MAPK12)	PF00069	30.342 (71/234)	2.63E-17
Cyclin-dependent kinase 2 (CDK2)	PF00069	27.309 (68/249)	2.92E-17
Stress-activated protein kinase 2a (p38 alpha)	PF00069	30.992 (75/242)	3.04E-17
Serine/threonine-protein kinase PAK 5 (PAK5)	PF00786 ; PF00069	28.293 (58/205)	3.25E-17
Cyclin-dependent kinase 12 (CDK12)	PF00069	28.452 (68/239)	3.92E-17
Ribosomal protein S6 kinase alpha-2 (RSK2)	PF00069 ; PF00433	28.112 (70/249)	5.63E-17
Serine/threonine-protein kinase ICK (CILK1)	PF00069	30.508 (72/236)	7.32E-17
Extracellular signal-regulated kinase 2 (ERK2)	PF00069	28.293 (58/205)	7.95E-17
Ribosomal protein S6 kinase alpha-1 (RSK1)	PF00069 ; PF00433	27.016 (67/248)	8.01E-17
Cyclin-dependent kinase 1 (CDK1)	PF00069	27.675 (75/271)	9.16E-17
Misshapen-like kinase 1 (MINK1)	PF00780 ; PF00069	28.283 (56/198)	1.51E-16
BR serine/threonine kinase 1 (BRSK1)	PF00069	29.020 (74/255)	1.79E-16
PKC-delta-interacting protein kinase (RIPK4)	PF12796 ; PF00069	29.225 (83/284)	2.34E-16
NIMA-related kinase 1 (NEK1)	PF00069	25.573 (67/262)	2.64E-16
Salt-inducible kinase 1 (SIK1)	PF00069	30.588 (78/255)	2.76E-16
Putative serine/threonine-protein kinase SIK1B (SIK1B)	PF00069	30.588 (78/255)	2.88E-16
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G)	PF00069	27.376 (72/263)	3.31E-16
SNF-related serine/threonine-protein kinase (SNRK)	PF00069	26.255 (68/259)	3.44E-16
Serine/threonine-protein kinase PLK3 (PLK3)	PF00069 ; PF00659	26.563 (68/256)	5.74E-16
Serine/threonine-protein kinase ULK2 (ULK2)	PF12063 ; PF00069	30.097 (62/206)	6.61E-16
Cyclin-dependent kinase 15 (CDK15)	PF00069	30.455 (67/220)	6.79E-16
Extracellular signal-regulated kinase 1 (ERK1)	PF00069	28.293 (58/205)	8.16E-16
Polo-like kinase 4 (PLK4)	PF00069 ; PF18190 ; PF18409 More >>	27.559 (70/254)	8.18E-16
Ribosomal protein S6 kinase alpha-6 (RSK6)	PF00069 ; PF00433	24.906 (66/265)	8.37E-16
Serine/threonine-protein kinase MAK (MAK)	PF00069	32.105 (61/190)	1.13E-15
Cyclin-dependent kinase 16 (CDK16)	PF12330 ; PF00069	28.700 (64/223)	1.22E-15
MST-1 protein kinase (STK4)	PF11629 ; PF00069	25.781 (66/256)	1.48E-15
Serine/threonine-protein kinase 3 (STK3)	PF11629 ; PF00069	25.556 (69/270)	1.54E-15
Protein kinase C alpha (PRKCA)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	28.571 (60/210)	1.58E-15
MEK kinase kinase 4 (MAP4K4)	PF00780 ; PF00069	27.919 (55/197)	2.04E-15
Myosin light chain kinase family member 4 (MYLK4)	PF00069	30.806 (65/211)	2.13E-15
Polo-like kinase 1 (PLK1)	PF00069 ; PF00659	26.378 (67/254)	2.20E-15
PAK-2 protein kinase (PAK2)	PF00786 ; PF00069	26.190 (66/252)	2.39E-15
Cyclin-dependent kinase 9 (CDK9)	PF00069	29.952 (62/207)	2.63E-15
MAPK/ERK kinase kinase 3 (MAP3K3)	PF00564 ; PF00069	30.542 (62/203)	2.77E-15
MEK kinase kinase 3 (MAP4K3)	PF00780 ; PF00069	26.007 (71/273)	2.83E-15
ERK activator kinase 5 (MAP2K5)	PF00564 ; PF00069	27.675 (75/271)	3.21E-15
Cyclin-dependent kinase 17 (CDK17)	PF12330 ; PF00069	28.070 (64/228)	3.67E-15
Serine/threonine-protein kinase ULK1 (ULK1)	PF12063 ; PF00069	28.780 (59/205)	4.31E-15
Serine/threonine-protein kinase PAK 6 (PAK6)	PF00786 ; PF00069	25.843 (69/267)	4.82E-15
Leucine-rich repeat serine/threonine-protein kinase 1 (LRRK1)	PF12796 ; PF16095 ; PF00069 ; PF08477 More >>	29.004 (67/231)	6.78E-15
Stress-activated protein kinase 2b (p38 beta)	PF00069	28.226 (70/248)	7.10E-15
Serine/threonine-protein kinase TAO2 (TAOK2)	PF00069	28.571 (72/252)	7.68E-15
Serine/threonine-protein kinase PAK 3 (PAK3)	PF00786 ; PF00069	26.104 (65/249)	8.50E-15
Protein kinase C theta (PRKCQ)	PF00130 ; PF00069 ; PF00433 More >>	25.455 (56/220)	8.89E-15
Cyclin-dependent kinase 14 (CDK14)	PF00069	27.778 (60/216)	1.21E-14
MEK kinase kinase 1 (MAP4K1)	PF00780 ; PF00069	27.863 (73/262)	1.46E-14
IL-1 receptor-associated kinase 1 (IRAK1)	PF00531 ; PF00069	27.619 (58/210)	1.47E-14
Myosin-IIIa (MYO3A)	PF00612 ; PF00063 ; PF00069 More >>	26.199 (71/271)	1.51E-14
Cyclin-dependent kinase 18 (CDK18)	PF00069	27.354 (61/223)	1.88E-14
Calcium/calmodulin-dependent protein kinase type 1D (CAMK1D)	PF00069	25.912 (71/274)	2.13E-14
Protein kinase C beta (PRKCB)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	26.667 (56/210)	2.18E-14
PAK-1 protein kinase (PAK1)	PF00786 ; PF00069	25.301 (63/249)	2.59E-14
Serine/threonine-protein kinase NIM1 (NIM1K)	PF00069	27.347 (67/245)	2.68E-14
Death-associated protein kinase 3 (DAPK3)	PF00069	27.982 (61/218)	2.88E-14
Mitogen-activated protein kinase 4 (MAPK4)	PF00069	31.111 (70/225)	3.19E-14
Protein kinase C delta (PRKCD)	PF00130 ; PF00069 ; PF00433 More >>	27.064 (59/218)	3.70E-14
Myosin light kinase (MYLK)	PF16620 ; PF00041 ; PF07679 ; PF00069 More >>	32.075 (68/212)	4.02E-14
Mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)	PF00780 ; PF00069	26.950 (76/282)	4.22E-14
Serine/threonine-protein kinase Nek9 (NEK9)	PF00069 ; PF00415	23.333 (63/270)	4.59E-14
Maternal embryonic leucine zipper kinase (MELK)	PF02149 ; PF00069	27.341 (73/267)	5.14E-14
Cyclin-dependent kinase-like 2 (CDKL2)	PF00069	30.882 (63/204)	5.32E-14
Hormonally up-regulated neu tumor-associated kinase (HUNK)	PF00069	28.571 (58/203)	5.40E-14
Serine/threonine-protein kinase 33 (STK33)	PF00069	27.477 (61/222)	6.41E-14
Checkpoint kinase-1 (CHK1)	PF00069	29.949 (59/197)	6.95E-14
Unc-51 like kinase 3 (ULK3)	PF04212 ; PF00069	26.199 (71/271)	7.77E-14
Fused homolog (STK36)	PF13646 ; PF00069	28.571 (56/196)	9.00E-14
Serine/threonine-protein kinase 32A (STK32A)	PF00069	25.180 (70/278)	1.12E-13
Cyclin-dependent kinase-like 3 (CDKL3)	PF00069	28.372 (61/215)	1.15E-13
Death-associated protein kinase 1 (DAPK1)	PF00023 ; PF12796 ; PF13637 ; PF00531 ; PF00069 More >>	28.814 (51/177)	1.49E-13
TAO kinase 3 (TAOK3)	PF00069	29.719 (74/249)	1.58E-13
PAK-4 protein kinase (PAK4)	PF00786 ; PF00069	26.829 (55/205)	1.62E-13
MEK kinase kinase 2 (MAP4K2)	PF00780 ; PF00069	25.368 (69/272)	1.68E-13
Myosin light chain kinase 3 (MYLK3)	PF00069	28.846 (75/260)	1.86E-13
Activin receptor type IB (ACVR1B)	PF01064 ; PF00069 ; PF08515 More >>	29.747 (47/158)	2.15E-13
Testis-specific serine kinase 2 (TSSK2)	PF00069	22.917 (55/240)	2.24E-13
TGF-beta receptor type I (TGFBR1)	PF01064 ; PF00069 ; PF08515 More >>	30.189 (48/159)	2.34E-13
Inhibitor of nuclear factor kappa-B kinase alpha (IKKA)	PF18397 ; PF12179 ; PF00069 More >>	31.527 (64/203)	2.46E-13
Mitogen-activated protein kinase 6 (MAPK6)	PF00069	28.261 (65/230)	2.50E-13
Serine/threonine-protein kinase Nek8 (NEK8)	PF00069 ; PF00415	23.790 (59/248)	2.63E-13
Death-associated protein kinase 2 (DAPK2)	PF00069	26.122 (64/245)	3.36E-13
Aurora kinase A (AURKA)	PF00069	23.396 (62/265)	3.69E-13
Serine/threonine-protein kinase WNK1 (WNK1)	PF12202 ; PF00069	28.516 (73/256)	4.24E-13
Mitogen-activated protein kinase 13 (MAPK13)	PF00069	27.234 (64/235)	4.27E-13
Calcium/calmodulin-dependent protein kinase type 1B (PNCK)	PF00069	25.403 (63/248)	4.34E-13
MAPK/ERK kinase kinase 2 (MAP3K2)	PF00564 ; PF00069	29.808 (62/208)	4.90E-13
Testis-specific serine/threonine-protein kinase 4 (TSSK4)	PF00069	25.203 (62/246)	4.97E-13
Mitogen-activated protein kinase 15 (MAPK15)	PF00069	27.897 (65/233)	5.06E-13
WNK lysine-deficient protein kinase 3 (WNK3)	PF12202 ; PF00069	27.734 (71/256)	5.87E-13
Casein kinase I delta (CSNK1D)	PF00069	26.449 (73/276)	6.79E-13
NIMA-related kinase 2 (NEK2)	PF00069	23.622 (60/254)	8.11E-13
Calcium/calmodulin-dependent protein kinase type 1 (CAMK1)	PF00069	26.641 (69/259)	8.28E-13
TAO kinase 1 (TAOK1)	PF00069	28.458 (72/253)	9.05E-13
Serine/threonine-protein kinase PRP4 homolog (PRPF4B)	PF00069	28.436 (60/211)	9.72E-13
Serine/threonine-protein kinase NLK (NLK)	PF00069	27.751 (58/209)	1.53E-12
ERK activator kinase 2 (MEK2)	PF00069	30.247 (49/162)	1.62E-12
G protein-coupled receptor kinase 5 (GRK5)	PF00069 ; PF00615	27.027 (60/222)	1.78E-12
Cyclin-dependent kinase 20 (CDK20)	PF00069	29.437 (68/231)	2.39E-12
Extracellular signal-regulated kinase 5 (ERK5)	PF00069	28.169 (60/213)	3.37E-12
Doublecortin-like kinase 1 (DCLK1)	PF03607 ; PF00069	25.773 (75/291)	3.72E-12
Protein kinase C gamma (PRKCG)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	27.442 (59/215)	3.91E-12
ERK activator kinase 7 (MAP2K7)	PF00069	27.612 (74/268)	4.75E-12
Serine/threonine-protein kinase H2 (PSKH2)	PF00069	27.315 (59/216)	4.85E-12
Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P)	PF00069	25.500 (51/200)	4.93E-12
Testis-specific serine/threonine-protein kinase 1 (TSSK1B)	PF00069	22.917 (55/240)	5.98E-12
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)	PF00069	24.583 (59/240)	6.05E-12
Serine/threonine-protein kinase WNK2 (WNK2)	PF12202 ; PF00069	29.412 (60/204)	6.51E-12
Protein kinase G2 (PRKG2)	PF00027 ; PF00069	25.483 (66/259)	6.63E-12
Protein kinase C epsilon (PRKCE)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	25.238 (53/210)	6.75E-12
Cyclin-dependent kinase 7 (CDK7)	PF00069	26.638 (61/229)	7.07E-12
Cyclin-dependent kinase 6 (CDK6)	PF00069	26.368 (53/201)	7.09E-12
Ribosomal protein S6 kinase alpha-5 (RSK5)	PF00069 ; PF00433	25.912 (71/274)	7.62E-12
Phosphoinositide dependent protein kinase-1 (PDPK1)	PF14593 ; PF00069	26.131 (52/199)	7.86E-12
Casein kinase I epsilon (CSNK1E)	PF00069	25.725 (71/276)	1.12E-11
MAPK/ERK kinase kinase 4 (MAP3K4)	PF19431 ; PF00069	22.709 (57/251)	1.16E-11
CDC42 binding protein kinase alpha (DMPK-like alpha)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 ; PF00433 More >>	27.064 (59/218)	1.18E-11
G protein-coupled receptor kinase 6 (GRK6)	PF00069 ; PF00615	26.577 (59/222)	1.31E-11
cAMP-dependent protein kinase catalytic subunit beta (PRKACB)	PF00069	24.710 (64/259)	1.45E-11
Serine/threonine-protein kinase H1 (PSKH1)	PF00069	24.390 (60/246)	1.53E-11
Serine/threonine-protein kinase WNK4 (WNK4)	PF12202 ; PF00069	26.812 (74/276)	1.76E-11
Inhibitor of nuclear factor kappa-B kinase beta (IKKB)	PF18397 ; PF12179 ; PF00069 More >>	27.004 (64/237)	1.99E-11
Aurora kinase C (AURKC)	PF00069	24.335 (64/263)	2.31E-11
Inhibitor of nuclear factor kappa-B kinase subunit epsilon (IKBKE)	PF00069 ; PF18394 ; PF18396 More >>	28.910 (61/211)	3.36E-11
Yet another novel kinase 2 (STK32B)	PF00069	26.636 (57/214)	3.37E-11
Dual specificity mitogen-activated protein kinase kinase 4 (MAP2K4)	PF00069	31.944 (46/144)	3.44E-11
NF-kappa-B-activating kinase (TBK1)	PF00069 ; PF18394 ; PF18396 More >>	27.230 (58/213)	3.58E-11
CaM-kinase IV kinase (CAMKK1)	PF00069	30.380 (48/158)	4.10E-11
ERK activator kinase 1 (MEK1)	PF00069	27.000 (54/200)	4.16E-11
Homeodomain-interacting protein kinase 4 (HIPK4)	PF00069	30.144 (63/209)	4.23E-11
Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)	PF00069	26.259 (73/278)	5.75E-11
Cyclin-dependent kinase-like 1 (CDKL1)	PF00069	27.411 (54/197)	5.86E-11
TBC domain-containing protein kinase-like protein (TBCK)	PF00069 ; PF00566 ; PF00581 More >>	26.667 (68/255)	6.20E-11
Serine/threonine-protein kinase MRCK beta (CDC42BPB)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 More >>	26.957 (62/230)	7.04E-11
Serine/threonine-protein kinase pim-1 (PIM1)	PF00069	30.061 (49/163)	8.15E-11
Interleukin-1 receptor-associated kinase-like 2 (IRAK2)	PF00531 ; PF00069	26.904 (53/197)	8.34E-11
Calcium/calmodulin-dependent protein kinase type IV (CAMK4)	PF00069	28.037 (60/214)	8.51E-11
Ribosomal protein S6 kinase beta-2 (RPS6KB2)	PF00069 ; PF00433	25.610 (63/246)	9.31E-11
Protein kinase G1 (PRKG1)	PF00027 ; PF16808 ; PF00069 More >>	27.273 (66/242)	9.93E-11
Calmodulin-dependent kinase II (CAMKK2)	PF00069	29.299 (46/157)	9.94E-11
Serine/threonine-protein kinase SBK2 (SBK2)	PF00069	32.663 (65/199)	1.00E-10
Cyclin-dependent kinase-like 5 (CDKL5)	PF00069	27.363 (55/201)	1.05E-10
Serine/threonine-protein kinase STK11 (STK11)	PF00069	26.267 (57/217)	1.12E-10
RAC-gamma serine/threonine-protein kinase (AKT3)	PF00169 ; PF00069 ; PF00433 More >>	23.333 (56/240)	1.22E-10
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)	PF00069	24.167 (58/240)	1.33E-10
Nik-related protein kinase (NRK)	PF00780 ; PF00069	26.087 (48/184)	1.48E-10
Ribosomal protein S6 kinase beta-1 (S6K1)	PF00069 ; PF00433	26.577 (59/222)	1.51E-10
Mitogen-activated protein kinase kinase kinase 15 (MAP3K15)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	29.897 (58/194)	1.66E-10
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6)	PF00069	27.305 (77/282)	1.87E-10
Protein kinase N2 (PKN2)	PF02185 ; PF00069 ; PF00433 More >>	29.108 (62/213)	1.90E-10
Testis-specific serine/threonine-protein kinase 3 (TSSK3)	PF00069	27.234 (64/235)	1.96E-10
Serine/threonine-protein kinase 17B (STK17B)	PF00069	28.333 (51/180)	2.44E-10
Myosin-IIIb (MYO3B)	PF00612 ; PF00063 ; PF00069 More >>	24.638 (68/276)	2.46E-10
Tyrosine-protein kinase EIF2AK2 (p68)	PF00035 ; PF00069	27.642 (34/123)	2.56E-10
Serine/threonine-protein kinase SBK1 (SBK1)	PF00069	28.497 (55/193)	2.80E-10
Serine/threonine-protein kinase Sgk2 (SGK2)	PF00069 ; PF00433	23.868 (58/243)	3.01E-10
STE20-related serine/threonine-protein kinase (SLK)	PF00069 ; PF12474	29.717 (63/212)	3.02E-10
Protein kinase C eta type (PRKCH)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	24.762 (52/210)	3.18E-10
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A)	PF08332 ; PF00069	25.573 (67/262)	3.29E-10
Cyclin-dependent kinase 19 (CDK19)	PF00069	27.536 (57/207)	3.33E-10
Cyclin-dependent kinase 8 (CDK8)	PF00069	27.184 (56/206)	4.38E-10
MAPK/ERK kinase kinase 1 (MAP3K1)	PF00069	27.723 (56/202)	4.84E-10
Serine/threonine-protein kinase D2 (PRKD2)	PF00130 ; PF00069	26.984 (51/189)	6.13E-10
IL-1 receptor-associated kinase 3 (IRAK3)	PF00531 ; PF00069	24.653 (71/288)	6.13E-10
STE20-related kinase adapter protein alpha (STRADA)	PF00069	27.895 (53/190)	6.32E-10
Cytoplasmic DRAK1 (STK17A)	PF00069	26.667 (52/195)	6.69E-10
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B)	PF08332 ; PF00069	22.541 (55/244)	7.33E-10
Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMK2G)	PF08332 ; PF00069	24.891 (57/229)	7.60E-10
Cyclin-dependent kinase 10 (CDK10)	PF00069	28.788 (57/198)	8.12E-10
G protein-coupled receptor kinase 4 (GRK4)	PF00069 ; PF00615	24.444 (55/225)	8.43E-10
RAC-alpha serine/threonine-protein kinase (AKT1)	PF00169 ; PF00069 ; PF00433 More >>	25.207 (61/242)	8.50E-10
Casein kinase I alpha (CSNK1A1)	PF00069	23.488 (66/281)	9.04E-10
RAC-beta serine/threonine-protein kinase (AKT2)	PF00169 ; PF00069 ; PF00433 More >>	22.500 (54/240)	9.14E-10
Serine/threonine-protein kinase tousled-like 2 (TLK2)	PF00069	28.652 (51/178)	9.44E-10
Stress-activated protein kinase JNK3 (JNK3)	PF00069	26.804 (52/194)	9.64E-10
Citron Rho-interacting kinase (CIT)	PF00780 ; PF00169 ; PF00069 More >>	26.087 (54/207)	1.09E-09
Serine/threonine-protein kinase 32C (STK32C)	PF00069	27.317 (56/205)	1.13E-09
Cyclin-dependent kinase 11A (CDK11A)	PF00069	27.830 (59/212)	1.15E-09
Ribosomal protein S6 kinase alpha-4 (RPS6KA4)	PF00069 ; PF00433	25.385 (66/260)	1.32E-09
Cyclin-dependent kinase 11B (CDK11B)	PF00069	27.830 (59/212)	1.40E-09
Serine/threonine-protein kinase MRCK gamma (CDC42BPG)	PF00130 ; PF00780 ; PF08826 ; PF00069 More >>	26.697 (59/221)	1.44E-09
Testis-specific serine/threonine-protein kinase 6 (TSSK6)	PF00069	25.197 (64/254)	1.75E-09
Casein kinase I isoform alpha-like (CSNK1A1L)	PF00069	22.939 (64/279)	1.87E-09
Stress-activated protein kinase JNK1 (JNK1)	PF00069	26.702 (51/191)	2.38E-09
Serine/threonine-protein kinase 10 (STK10)	PF00069 ; PF12474	27.358 (58/212)	2.58E-09
Protein kinase D (PRKD1)	PF00130 ; PF00169 ; PF00069 More >>	25.957 (61/235)	2.60E-09
MAPK-activated protein kinase 3 (MAPKAPK3)	PF00069	25.926 (49/189)	2.65E-09
Cyclin-dependent kinase-like 4 (CDKL4)	PF00069	25.632 (71/277)	2.72E-09
Anti-mullerian hormone II receptor (AMHR2)	PF00069	23.226 (72/310)	2.90E-09
Endoplasmic reticulum to nucleus signaling 1 (ERN1)	PF00069 ; PF06479	22.022 (61/277)	3.07E-09
Serine/threonine-protein kinase Chk2 (RAD53)	PF00498 ; PF00069	28.986 (60/207)	3.08E-09
Apoptosis signal-regulating kinase 1 (MAP3K5)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	27.016 (67/248)	3.74E-09
Serine/threonine-protein kinase Nek10 (NEK10)	PF00069	25.564 (68/266)	3.90E-09
Homeodomain-interacting protein kinase 3 (HIPK3)	PF00069	25.909 (57/220)	4.07E-09
CDC-like kinase 3 (CLK3)	PF00069	25.322 (59/233)	5.48E-09
Doublecortin-like kinase 2 (DCLK2)	PF03607 ; PF00069	24.314 (62/255)	6.29E-09
Homeodomain-interacting protein kinase 1 (HIPK1)	PF00069	26.244 (58/221)	7.17E-09
Serine/threonine-protein kinase D3 (PRKD3)	PF00130 ; PF00169 ; PF00069 More >>	26.984 (51/189)	7.44E-09
Cyclin-dependent kinase 4 (CDK4)	PF00069	25.604 (53/207)	8.28E-09
Serine/threonine-protein kinase tousled-like 1 (TLK1)	PF00069	29.775 (53/178)	8.89E-09
Aurora kinase B (AURKB)	PF00069	24.138 (63/261)	9.25E-09
Serine/threonine-protein kinase Sgk1 (SGK1)	PF00069 ; PF00433	24.870 (48/193)	1.05E-08
Phosphorylase kinase testis gamma 2 (PHKG2)	PF00069	24.255 (57/235)	1.22E-08
Rho-associated protein kinase 2 (ROCK2)	PF00069 ; PF08912	27.184 (56/206)	1.28E-08
Stress-activated protein kinase JNK2 (JNK2)	PF00069	27.879 (46/165)	1.47E-08
Rhodopsin kinase GRK7 (GRK7)	PF00069 ; PF00615	26.761 (57/213)	1.54E-08
Doublecortin-like kinase 3 (DCLK3)	PF00069	28.667 (43/150)	1.83E-08
Activin receptor type IIB (ACVR2B)	PF01064 ; PF00069	25.688 (56/218)	1.89E-08
Rho-associated protein kinase 1 (ROCK1)	PF00069 ; PF08912	27.184 (56/206)	2.09E-08
Serine/threonine kinase-like domain-containing protein STKLD1 (STKLD1)	PF00069	29.474 (28/95)	2.64E-08
Calcium/calmodulin-dependent protein kinase type II subunit delta (CAMK2D)	PF08332 ; PF00069	25.098 (64/255)	2.65E-08
Membrane-associated kinase (PKMYT1)	PF00069	27.972 (40/143)	2.89E-08
Putative serine/threonine-protein kinase PRKY (PRKY)	PF00069	25.258 (49/194)	3.18E-08
MAPK/MAK/MRK overlapping kinase (MOK)	PF00069	27.179 (53/195)	3.41E-08
Obscurin (OBSCN)	PF00041 ; PF07679 ; PF00612 ; PF00069 ; PF00621 More >>	26.554 (47/177)	3.53E-08
Serine/threonine-protein kinase greatwall (MASTL)	PF00069	25.175 (36/143)	4.01E-08
PIM-3 protein kinase (PIM3)	PF00069	29.310 (51/174)	4.51E-08
Homeodomain interacting protein kinase 2 (HIPK2)	PF00069	25.455 (56/220)	4.94E-08
Bone morphogenetic protein receptor (BMPR2)	PF01064 ; PF00069	24.370 (58/238)	5.16E-08
Activin receptor type IIA (ACVR2A)	PF01064 ; PF00069	28.873 (41/142)	5.81E-08
STE20-related kinase adapter protein beta (STRADB)	PF00069	25.824 (47/182)	5.91E-08
Tau-tubulin kinase 2 (TTBK2)	PF00069	22.648 (65/287)	6.01E-08
Wee1-like protein kinase (WEE1)	PF00069	22.989 (60/261)	7.09E-08
cAMP-dependent protein kinase catalytic subunit PRKX (PRKX)	PF00069	25.333 (38/150)	7.31E-08
Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1)	PF00069	29.268 (48/164)	7.44E-08
Dual-specificity tyrosine-phosphorylation regulated kinase 1B (DYRK1B)	PF00069	26.794 (56/209)	8.25E-08
Serine/threonine-protein kinase pim-2 (PIM2)	PF00069	27.027 (40/148)	9.78E-08
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (PHKG1)	PF00069	26.061 (43/165)	1.00E-07
Apoptosis signal-regulating kinase 2 (MAP3K6)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	25.253 (50/198)	1.02E-07
TGF-beta-stimulated factor 1 (STK16)	PF00069	24.444 (66/270)	1.09E-07
PAS domain-containing serine/threonine-protein kinase (PASK)	PF13426 ; PF00069	23.045 (56/243)	1.11E-07
Serine/threonine-protein kinase NIK (MAP3K14)	PF00069	26.667 (52/195)	1.31E-07
CDC-like kinase 1 (CLK1)	PF00069	26.141 (63/241)	1.39E-07
Dual-specificity tyrosine-phosphorylation regulated kinase 3 (DYRK3)	PF00069	25.417 (61/240)	1.53E-07
Striated muscle preferentially expressed protein kinase (SPEG)	PF07679 ; PF00069 ; PF16650 More >>	22.396 (43/192)	1.69E-07
Protein kinase N1 (PKN1)	PF02185 ; PF00069 ; PF00433 More >>	26.244 (58/221)	1.71E-07
Kalirin (KALRN)	PF13716 ; PF00041 ; PF07679 ; PF00169 ; PF00069 ; PF00621 ; PF16609 ; PF00435 More >>	22.634 (55/243)	1.75E-07
Dual-specificity tyrosine-phosphorylation regulated kinase 2 (DYRK2)	PF00069	26.154 (51/195)	3.09E-07
Eukaryotic translation initiation factor 2-alpha kinase 4 (EIF2AK4)	PF12745 ; PF00069 ; PF05773 ; PF13393 More >>	38.667 (29/75)	3.41E-07
Cyclin-G-associated kinase (GAK)	PF00069 ; PF10409	25.874 (74/286)	3.49E-07
Protein kinase N3 (PKN3)	PF02185 ; PF00069 ; PF00433 More >>	28.700 (64/223)	3.58E-07
Ribosomal protein S6 kinase-related protein (RSKR)	PF00069	31.373 (32/102)	4.06E-07
MAPK-activated protein kinase 2 (MAPKAPK2)	PF00069	22.751 (43/189)	5.69E-07
BMP-2-inducible protein kinase (BMP2K)	PF15282 ; PF00069	21.831 (62/284)	5.91E-07
Wee1-like protein kinase 2 (WEE2)	PF00069	24.542 (67/273)	6.42E-07
Serine/threonine-protein kinase cot (COT)	PF00069	22.177 (55/248)	7.48E-07
Titin (TTN)		23.364 (50/214)	7.69E-07
Microtubule-associated serine/threonine-protein kinase 3 (MAST3)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	23.427 (67/286)	7.75E-07
Protein kinase C iota (PRKCI)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	22.311 (56/251)	9.97E-07
Dual-specificity tyrosine-phosphorylation regulated kinase 1A (DYRK1A)	PF00069	26.733 (54/202)	1.07E-06
PDZ binding kinase (PBK)	PF00069	20.968 (52/248)	1.35E-06
Serine/threonine-protein kinase Sgk3 (SGK3)	PF00069 ; PF00433 ; PF00787 More >>	23.618 (47/199)	1.44E-06
Glycogen synthase kinase-3 alpha (GSK-3A)	PF00069	28.502 (59/207)	1.73E-06
CDC-like kinase 4 (CLK4)	PF00069	24.464 (57/233)	1.81E-06
Sugen kinase 110 (SBK3)	PF00069	27.273 (42/154)	2.22E-06
Tau-tubulin kinase (TTBK1)	PF00069	21.708 (61/281)	2.30E-06
Microtubule-associated serine/threonine-protein kinase 4 (MAST4)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	23.741 (66/278)	2.45E-06
CDC-like kinase 2 (CLK2)	PF00069	25.214 (59/234)	2.73E-06
Casein kinase I gamma-2 (CSNK1G2)	PF12605 ; PF00069	23.551 (65/276)	2.94E-06
Casein kinase I gamma-1 (CSNK1G1)	PF12605 ; PF00069	23.827 (66/277)	2.98E-06
NDR2 protein kinase (STK38L)	PF00069 ; PF00433	25.974 (40/154)	3.39E-06
Dual specificity protein kinase TTK (MPS1)	PF00069	21.778 (49/225)	4.79E-06
NDR1 protein kinase (STK38)	PF00069 ; PF00433	26.623 (41/154)	5.57E-06
Large tumor suppressor homolog 2 (LATS2)	PF00069 ; PF00433	25.333 (38/150)	8.11E-06
Serine/threonine-protein kinase PDIK1L (PDIK1L)	PF00069	23.834 (46/193)	8.28E-06
Casein kinase I gamma-3 (CSNK1G3)	PF12605 ; PF00069	23.273 (64/275)	8.47E-06
PRKR-like endoplasmic reticulum kinase (PERK)	PF00069	26.471 (27/102)	9.59E-06
Microtubule-associated serine/threonine-protein kinase 2 (MAST2)	PF08926 ; PF17820 ; PF00069 More >>	23.504 (55/234)	9.60E-06
Rhodopsin kinase GRK1 (GRK1)	PF00069 ; PF00615	22.619 (57/252)	1.04E-05
Serine/threonine-protein kinase 35 (STK35)	PF00069	26.974 (41/152)	1.19E-05
Dual-specificity tyrosine-phosphorylation regulated kinase 4 (DYRK4)	PF00069	24.257 (49/202)	1.25E-05
Serine/threonine-protein kinase LATS1 (LATS1)	PF00069 ; PF00627	24.405 (41/168)	1.59E-05
Microtubule-associated serine/threonine-protein kinase 1 (MAST1)	PF08926 ; PF17820 ; PF00069 More >>	24.000 (60/250)	1.65E-05
Glycogen synthase kinase-3 beta (GSK-3B)	PF00069	26.761 (57/213)	1.96E-05
Protein kinase C zeta (PRKCZ)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	21.481 (58/270)	2.77E-05
Myotonin-protein kinase (DMPK)	PF08826 ; PF00069	25.166 (38/151)	3.09E-05
CaM kinase-like vesicle-associated protein (CAMKV)	PF00069	22.941 (39/170)	5.70E-05
MAPK-activated protein kinase 5 (MAPKAPK5)	PF00069	25.362 (35/138)	9.90E-05
Nebulin (NEB)	PF00880 ; PF14604	31.683 (32/101)	1.06E-04
Serine/threonine-protein kinase ULK4 (ULK4)	PF00069	21.091 (58/275)	1.08E-04
Serine/threonine-protein kinase Kist (UHMK1)	PF00069 ; PF00076	25.595 (43/168)	1.22E-04
Endophilin-A1 (SH3GL2)	PF03114 ; PF07653	32.184 (28/87)	1.52E-04
SH3 and cysteine-rich domain-containing protein 2 (STAC2)	PF00130 ; PF14604 ; PF16664 More >>	28.070 (16/57)	2.69E-04
Rho guanine nucleotide exchange factor 7 (ARHGEF7)	PF00307 ; PF00169 ; PF00621 ; PF16615 ; PF16614 ; PF07653 More >>	33.962 (18/53)	2.93E-04
Beta-adrenergic receptor kinase 1 (ADRBK1)	PF00169 ; PF00069 ; PF00615 More >>	25.604 (53/207)	3.52E-04
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

KEGG Pathway	Pathway ID	Affiliated Target	Pathway Map
Adherens junction	hsa04520	Affiliated Target
Class: Cellular Processes => Cellular community - eukaryotes	Pathway Hierarchy

Degree	9	Degree centrality	9.67E-04	Betweenness centrality	6.83E-06
Closeness centrality	2.37E-01	Radiality	1.42E+01	Clustering coefficient	7.78E-01
Neighborhood connectivity	8.66E+01	Topological coefficient	2.03E-01	Eccentricity	11
Download	Click to Download the Full PPI Network of This Target

Chemical Structure based Activity Landscape of Target

Top

Target Poor or Non Binders

Top

Target Poor or Non Binders

Target Poor or Non Binders Info

Target Regulators

Top

Target-regulating microRNAs

Target-regulating microRNAs Info

Target-interacting Proteins

Target-interacting Proteins Info

Target Profiles in Patients

Top

Target Expression
Profile (TEP)

Target Expression Profile Info

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 2 KEGG Pathways

Adherens junction

Tight junction

NetPath Pathway

[+] 2 NetPath Pathways

IL5 Signaling Pathway

IL2 Signaling Pathway

Panther Pathway

[+] 3 Panther Pathways

Cadherin signaling pathway

Parkinson disease

CCKR signaling map ST

PID Pathway

[+] 15 PID Pathways

Noncanonical Wnt signaling pathway

Glypican 1 network

Signaling events mediated by PTP1B

Regulation of p38-alpha and p38-beta

CDC42 signaling events

Thromboxane A2 receptor signaling

Netrin-mediated signaling events

CXCR4-mediated signaling events

Class I PI3K signaling events

amb2 Integrin signaling

EPHA forward signaling

PDGFR-beta signaling pathway

Ephrin B reverse signaling

Alpha-synuclein signaling

Signaling events mediated by focal adhesion kinase

Reactome

[+] 10 Reactome Pathways

Regulation of KIT signaling

FCGR activation

PECAM1 interactions

EPH-Ephrin signaling

CD28 co-stimulation

CTLA4 inhibitory signaling

EPHB-mediated forward signaling

EPHA-mediated growth cone collapse

EPH-ephrin mediated repulsion of cells

Regulation of signaling by CBL

WikiPathways

[+] 4 WikiPathways

Signaling by SCF-KIT

Interleukin-11 Signaling Pathway

TSLP Signaling Pathway

Costimulation by the CD28 family

Target-Related Models and Studies

Top

Target Validation

Target Validation Info

References

Top

REF 1

National Cancer Institute Drug Dictionary (drug id 596693).

REF 2

ClinicalTrials.gov (NCT00676299) A Safety and Dose-finding Study of JNJ-26483327, a Drug in Development for Cancer, for Patients With Advanced and/or Refractory Solid Malignancies.. U.S. National Institutes of Health.

REF 3

Discovery of [7-(2,6-dichlorophenyl)-5-methylbenzo [1,2,4]triazin-3-yl]-[4-(2-pyrrolidin-1-ylethoxy)phenyl]amine--a potent, orally active Src kinas... Bioorg Med Chem Lett. 2007 Feb 1;17(3):602-8.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN