Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T76093
(Former ID: TTDNC00420)
|
|||||
Target Name |
Proheparin-binding EGF-like growth factor (HBEGF)
|
|||||
Synonyms |
Proheparinbinding EGFlike growth factor; Heparinbinding EGFlike growth factor; Heparin-binding EGF-like growth factor; HEGFL; HB-EGF; Diphtheria toxin receptor; DTS; DTR; DT-R
|
|||||
Gene Name |
HBEGF
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Ovarian cancer [ICD-11: 2C73] | |||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor. Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4.
Click to Show/Hide
|
|||||
BioChemical Class |
Growth factor
|
|||||
UniProt ID | ||||||
Sequence |
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG LLMFRYHRRGGYDVENEEKVKLGMTNSH Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | KHK-2866 | Drug Info | Phase 1 | Ovarian cancer | [1] | |
2 | U3-1565 | Drug Info | Phase 1 | Solid tumour/cancer | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | U3-1565 | Drug Info | [3] |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | ClinicalTrials.gov (NCT01279291) Study of Anti-HB-EGF Antibody KHK2866 in Subjects With Advanced Solid Tumors and Ovarian Cancer. U.S. National Institutes of Health. | |||||
REF 2 | ClinicalTrials.gov (NCT01290471) Study to Assess the Safety and Tolerability of U3-1565 in Subjects With Advanced Solid Malignant Tumors. U.S. National Institutes of Health. | |||||
REF 3 | J Clin Oncol 31, 2013 (suppl; abstr 2519). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.