Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T89147
(Former ID: TTDI02177)
|
|||||
Target Name |
Superoxide dismutase Mn (SOD Mn)
|
|||||
Synonyms |
Superoxide dismutase [Mn], mitochondrial
Click to Show/Hide
|
|||||
Gene Name |
SOD2
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Pain [ICD-11: MG30-MG3Z] | |||||
Function |
Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
Click to Show/Hide
|
|||||
BioChemical Class |
Superoxide dismutase/reductase
|
|||||
UniProt ID | ||||||
EC Number |
EC 1.15.1.1
|
|||||
Sequence |
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
HIT2.0 ID | T70SFS |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | Imisopasem manganese | Drug Info | Phase 2 | Pain | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | Imisopasem manganese | Drug Info | [1], [3] |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
FoxO signaling pathway | hsa04068 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Peroxisome | hsa04146 | Affiliated Target |
|
Class: Cellular Processes => Transport and catabolism | Pathway Hierarchy | ||
Longevity regulating pathway | hsa04211 | Affiliated Target |
|
Class: Organismal Systems => Aging | Pathway Hierarchy | ||
Longevity regulating pathway - multiple species | hsa04213 | Affiliated Target |
|
Class: Organismal Systems => Aging | Pathway Hierarchy |
Degree | 20 | Degree centrality | 2.15E-03 | Betweenness centrality | 3.58E-03 |
---|---|---|---|---|---|
Closeness centrality | 2.37E-01 | Radiality | 1.42E+01 | Clustering coefficient | 1.84E-01 |
Neighborhood connectivity | 3.55E+01 | Topological coefficient | 1.01E-01 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
BioCyc | [+] 1 BioCyc Pathways | + | ||||
1 | Reactive oxygen species degradation | |||||
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | FoxO signaling pathway | |||||
2 | Peroxisome | |||||
3 | Huntington's disease | |||||
NetPath Pathway | [+] 3 NetPath Pathways | + | ||||
1 | IL1 Signaling Pathway | |||||
2 | TCR Signaling Pathway | |||||
3 | IL5 Signaling Pathway | |||||
PID Pathway | [+] 1 PID Pathways | + | ||||
1 | FoxO family signaling |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | The manganese superoxide dismutase mimetic, M40403, protects adult mice from lethal total body irradiation. Free Radic Res. 2010 May;44(5):529-40. | |||||
REF 2 | ClinicalTrials.gov (NCT00101621) Pilot Study to Evaluate the Safety and Analgesic Activity of M40403 Co-Administered With an Opioid Agent for Cancer Pain. U.S. National Institutes of Health. | |||||
REF 3 | M-40403 Metaphore Pharmaceuticals. IDrugs. 2005 Jan;8(1):67-76. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.