Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T72657
|
||||
Former ID |
TTDS00219
|
||||
Target Name |
30S ribosomal subunit
|
||||
Gene Name |
pbp2
|
||||
Synonyms |
30S ribosome subunit; pbp2
|
||||
Target Type |
Successful
|
||||
Disease | Acute and chronic intestinal amebiasis [ICD9: 6; ICD10: A06] | ||||
Acute hepatic failure; Alcoholic cirrhosis of liver [ICD9: 570, 571.1; ICD10: K71, K72] | |||||
Acne vulgaris [ICD9: 706.1; ICD10: L70.0] | |||||
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
Lyme disease; Acne; Bronchitis [ICD10: L70, J20-J21, J42] | |||||
Skin infections [ICD9: 680-709; ICD10: L00-L99] | |||||
Target Validation |
T72657
|
||||
UniProt ID | |||||
Sequence |
MTENKGSSQPKKNGNNGGKSNSKKNRNVKRTIIKIIGFMIIAFFVVLLLGILLFAYYAWK
APAFTEAKLQDPIPAKIYDKNGELVKTLDNGQRHEHVNLKDVPKSMKDAVLATEDNRFYE HGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQHKSIGRKAQEAYLSYRLEQ EYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNNYNIY DHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTAEERQNIDTNQDSEYN SYVNFVKSELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQV GATILDSKTGGLVAISGGRDFKDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHA IQDESSYQVDGSTFRNYDVKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPKKFAA KLGLNYEGDIGPSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETIEY DHTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTYGAETYSQYNLP DNAAKDVWINGFTPQYTMSVWMGFSKVKQYGENSFVGHSQQEYPQFLYENVMSKISSRDG EDFKRPSSVSGSIPSINVSGSQDNNTTNRSTHGGSDTSANSSGTAQSNNNTRSQQSRNSG GLTGIFN |
||||
Drugs and Mode of Action | |||||
Drug(s) | Amikacin | Drug Info | Approved | Bacterial infections | [1] |
Clomocycline | Drug Info | Approved | Bacterial infections | [2] | |
Demeclocycline | Drug Info | Approved | Lyme disease; Acne; Bronchitis | [3] | |
Framycetin | Drug Info | Approved | Bacterial infections | [4] | |
Kanamycin | Drug Info | Approved | Bacterial infections | [5] | |
Lymecycline | Drug Info | Approved | Bacterial infections | [6] | |
Meclocycline | Drug Info | Approved | Bacterial infections | [7] | |
Methacycline | Drug Info | Approved | Bacterial infections | [8] | |
Minocycline | Drug Info | Approved | Bacterial infections | [9] | |
Neomycin | Drug Info | Approved | Acute hepatic failure; Alcoholic cirrhosis of liver | [10], [11] | |
Netilmicin | Drug Info | Approved | Bacterial infections | [12] | |
Oxytetracycline | Drug Info | Approved | Bacterial infections | [13] | |
Paromomycin | Drug Info | Approved | Acute and chronic intestinal amebiasis | [14] | |
Rolitetracycline | Drug Info | Approved | Acne vulgaris | [15], [3] | |
Spectinomycin | Drug Info | Approved | Bacterial infections | [16] | |
Streptomycin | Drug Info | Approved | Bacterial infections | [17] | |
Tetracycline | Drug Info | Approved | Bacterial infections | [18] | |
Tigecycline | Drug Info | Approved | Skin infections | [19], [20], [21] | |
Binder | Amikacin | Drug Info | [22] | ||
Clomocycline | Drug Info | [2] | |||
Demeclocycline | Drug Info | [23] | |||
Framycetin | Drug Info | [24] | |||
Kanamycin | Drug Info | [25] | |||
Lymecycline | Drug Info | [26] | |||
Meclocycline | Drug Info | [23] | |||
Methacycline | Drug Info | [27] | |||
Minocycline | Drug Info | [28] | |||
Neomycin | Drug Info | [29] | |||
Netilmicin | Drug Info | [30] | |||
Oxytetracycline | Drug Info | [23] | |||
Paromomycin | Drug Info | [31], [32] | |||
Rolitetracycline | Drug Info | [15] | |||
Spectinomycin | Drug Info | [33] | |||
Streptomycin | Drug Info | [33], [34] | |||
Tetracycline | Drug Info | [35] | |||
Tigecycline | Drug Info | [20] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
DRM | DRM Info | ||||
References | |||||
REF 1 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | ||||
REF 2 | Molecular dynamics simulations of the 30S ribosomal subunit reveal a preferred tetracycline binding site. J Am Chem Soc. 2008 Jan 30;130(4):1114-5. | ||||
REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 4 | Drug information of Framycetin, 2008. eduDrugs. | ||||
REF 5 | Novel agents in the management of Mycobacterium tuberculosis disease. Curr Med Chem. 2007;14(18):2000-8. | ||||
REF 6 | Drug information of Lymecycline, 2008. eduDrugs. | ||||
REF 7 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 065094. | ||||
REF 8 | Drug information of Methacycline, 2008. eduDrugs. | ||||
REF 9 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
REF 10 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 060304. | ||||
REF 11 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 709). | ||||
REF 12 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
REF 13 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 060634. | ||||
REF 14 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 064171. | ||||
REF 15 | Reversed-phase high-performance liquid chromatography coupled to ultraviolet and electrospray time-of-flight mass spectrometry on-line detection for the separation of eight tetracyclines in honey samples. J Chromatogr A. 2008 Jun 27;1195(1-2):107-16. Epub 2008 May 10. | ||||
REF 16 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 050347. | ||||
REF 17 | Emerging drugs for chemotherapy-induced mucositis. Expert Opin Emerg Drugs. 2008 Sep;13(3):511-22. | ||||
REF 18 | How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. | ||||
REF 19 | Tigecycline (Tygacil): the first in the glycylcycline class of antibiotics. Proc (Bayl Univ Med Cent). 2006 Apr;19(2):155-61. | ||||
REF 20 | Tigecycline: first of a new class of antimicrobial agents. Pharmacotherapy. 2006 Aug;26(8):1099-110. | ||||
REF 21 | 2005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006). | ||||
REF 22 | Bacterial resistance to aminoglycosides and beta-lactams: the Tn1331 transposon paradigm. Front Biosci. 2000 Jan 1;5:D20-9. | ||||
REF 23 | Detection of tetracycline resistance genes by PCR methods. Methods Mol Biol. 2004;268:3-13. | ||||
REF 24 | Antistaphylococcal activity of gentamicin. Minerva Med. 1975 Dec 8;66(84):4505-26. | ||||
REF 25 | SsrA-mediated protein tagging in the presence of miscoding drugs and its physiological role in Escherichia coli. Genes Cells. 2002 Jul;7(7):629-38. | ||||
REF 26 | Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. | ||||
REF 27 | Tetracyclines and pulmonary inflammation. Endocr Metab Immune Disord Drug Targets. 2007 Dec;7(4):232-6. | ||||
REF 28 | Functional, biophysical, and structural bases for antibacterial activity of tigecycline. Antimicrob Agents Chemother. 2006 Jun;50(6):2156-66. | ||||
REF 29 | Characterization of a 30S ribosomal subunit assembly intermediate found in Escherichia coli cells growing with neomycin or paromomycin. Arch Microbiol. 2008 May;189(5):441-9. Epub 2007 Dec 5. | ||||
REF 30 | Ribosomal resistance in the gentamicin producer organism Micromonospora purpurea. Antimicrob Agents Chemother. 1982 Aug;22(2):231-6. | ||||
REF 31 | 30S ribosomal subunit assembly is a target for inhibition by aminoglycosides in Escherichia coli. Antimicrob Agents Chemother. 2002 May;46(5):1546-9. | ||||
REF 32 | Aminoglycoside association pathways with the 30S ribosomal subunit. J Phys Chem B. 2009 May 21;113(20):7322-30. | ||||
REF 33 | Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. | ||||
REF 34 | The interaction between streptomycin and ribosomal RNA. Biochimie. 1991 Dec;73(12):1431-8. | ||||
REF 35 | The glycylcyclines: a comparative review with the tetracyclines. Drugs. 2004;64(1):63-88. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.