Target General Infomation
Target ID
T78356
Former ID
TTDC00086
Target Name
Thromboxane-A synthase
Gene Name
TBXAS1
Synonyms
TS; TXA synthase; TXS; Thromboxane A2 synthase; TBXAS1
Target Type
Clinical Trial
Disease Asthma [ICD10: J45]
Angina pectoris [ICD9: 413; ICD10: I20]
Cardiac arrhythmias [ICD9: 427; ICD10: I47-I49]
Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51]
Nephritis [ICD10: N00-N19, N25-N29]
Type 2 diabetes [ICD9: 250; ICD10: E11]
Thrombosis [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82]
Thromboembolism [ICD9: 437.6, 453, 671.5, 671.9; ICD10: I80-I82]
Unspecified [ICD code not available]
BioChemical Class
Intramolecular oxidoreductases
Target Validation
T78356
UniProt ID
EC Number
EC 5.3.99.5
Sequence
MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFR
QGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSV
ADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQR
CYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLA
RILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIV
RDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATN
PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV
LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCL
GVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
Drugs and Mode of Action
Drug(s) PYRIDINE Drug Info Phase 4 Discovery agent [524763]
NM-702 Drug Info Phase 3 Angina pectoris [544180]
E-6700 Drug Info Phase 2 Asthma [534187]
EV-077 Drug Info Phase 2 Type 2 diabetes [523832]
FK-070 Drug Info Phase 2 Angina pectoris [534202]
G-619 Drug Info Phase 1 Thrombosis [534091]
NV-52 Drug Info Phase 1 Inflammatory bowel disease [547537]
ONO-1301 Drug Info Preclinical Angina pectoris [539261], [545843]
Satigrel Drug Info Discontinued in Preregistration Thromboembolism [544655]
Imitrodast Drug Info Discontinued in Phase 2 Asthma [544584]
MILACAINIDE TARTRATE Drug Info Discontinued in Phase 2 Cardiac arrhythmias [544939]
Rolafagrel Drug Info Discontinued in Phase 2 Nephritis [544896]
CGS-13080 Drug Info Terminated Asthma [544600]
Dazoxiben Drug Info Terminated Discovery agent [468236], [544646]
Inhibitor 2-(10-Imidazol-1-yl-decyl)-isoindole-1,3-dione Drug Info [533459]
2-(6-Imidazol-1-yl-hexyl)-isoindole-1,3-dione Drug Info [533459]
2-(8-Imidazol-1-yl-octyl)-isoindole-1,3-dione Drug Info [533459]
4-Methyl-pyridine Drug Info [533575]
5-(2-Imidazol-1-yl-ethyl)-7,8-dihydro-quinoline Drug Info [525760]
5-Imidazol-1-yl-5,6,7,8-tetrahydro-quinoline Drug Info [525760]
6-Imidazol-1-yl-isoquinoline Drug Info [525760]
CGS-13080 Drug Info [533494]
Dazoxiben Drug Info [537729]
Imitrodast Drug Info [533430]
NM-702 Drug Info [536325]
NV-52 Drug Info [536468], [536703]
ONO-1581 Drug Info [551276]
PYRIDINE Drug Info [533575]
Rolafagrel Drug Info [529293]
Modulator CV-6504.HCL Drug Info [537655]
E-6700 Drug Info [534187]
EV-077 Drug Info
FK-070 Drug Info [534202]
G-619 Drug Info [534091]
Satigrel Drug Info [534205]
Antagonist MILACAINIDE TARTRATE Drug Info [534278]
Agonist ONO-1301 Drug Info [531705]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
BioCyc Pathway C20 prostanoid biosynthesis
KEGG Pathway Arachidonic acid metabolism
Metabolic pathways
Platelet activation
PathWhiz Pathway Arachidonic Acid Metabolism
WikiPathways Prostaglandin Synthesis and Regulation
Arachidonic acid metabolism
Phase 1 - Functionalization of compounds
Eicosanoid Synthesis
References
Ref 468236(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5175).
Ref 523832ClinicalTrials.gov (NCT01551381) Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of EV-077 in Type 2 Diabetic Subjects. U.S. National Institutes of Health.
Ref 524763ClinicalTrials.gov (NCT02143167) Resistance Training and Amino Pyridine in Multiple Sclerosis. U.S. National Institutes of Health.
Ref 534091G 619, a dual thromboxane synthase inhibitor and thromboxane A2 receptor antagonist, inhibits tumor necrosis factor-alpha biosynthesis. Eur J Pharmacol. 1995 Nov 3;286(1):31-9.
Ref 534187Structure-activity relationships of (E)-3-(1,4-benzoquinonyl)-2-[(3-pyridyl)-alkyl]-2-propenoic acid derivatives that inhibit both 5-lipoxygenase and thromboxane A2 synthetase. J Med Chem. 1996 Aug 2;39(16):3148-57.
Ref 534202Pharmacokinetic and pharmacodynamic properties of FK070 (KDI-792), a novel thromboxane receptor antagonist/thromboxane synthetase inhibitor, after single and multiple oral administrations to healthy volunteers. J Pharm Pharmacol. 1996 Apr;48(4):380-5.
Ref 539261(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1964).
Ref 544180Application of adaptive design and decision making to a phase II trial of a phosphodiesterase inhibitor for the treatment of intermittent claudication. Trials. 2011; 12: 134.
Ref 544584Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000225)
Ref 544600Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000262)
Ref 544646Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000420)
Ref 544655Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000441)
Ref 544896Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001438)
Ref 544939Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001597)
Ref 545843Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005013)
Ref 547537Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017139)
Ref 525760J Med Chem. 2000 May 4;43(9):1841-51.1-imidazolyl(alkyl)-substituted di- and tetrahydroquinolines and analogues: syntheses and evaluation of dual inhibitors of thromboxane A(2) synthase and aromatase.
Ref 529293Inhibition by FCE 22178 of platelet and glomerular thromboxane synthase in animal and human kidney disease. Adv Prostaglandin Thromboxane Leukot Res. 1991;21B:707-10.
Ref 531705A synthetic prostacyclin agonist with thromboxane synthase inhibitory activity, ONO-1301, protects myocardium from ischemia/reperfusion injury. Eur J Pharmacol. 2012 Jan 15;674(2-3):352-8.
Ref 533430RS-5186, a novel thromboxane synthetase inhibitor with a potent and extended duration of action. Thromb Res. 1988 Sep 1;51(5):507-20.
Ref 533459J Med Chem. 1986 May;29(5):816-9.Thromboxane synthetase inhibitors and antihypertensive agents. 2. N-[(1H-imidazol-1-yl)alkyl]-1H-isoindole-1,3(2H)-diones and N-[(1H-1,2,4-triazol-1-yl)alkyl]-1H-isoindole-1,3(2H)-diones as unique antihypertensive agents.
Ref 533494J Med Chem. 1985 Feb;28(2):164-70.Imidazo[1,5-a]pyridines: a new class of thromboxane A2 synthetase inhibitors.
Ref 533575J Med Chem. 1981 Oct;24(10):1149-55.Highly selective inhibitors of thromboxane synthetase. 2. Pyridine derivatives.
Ref 534091G 619, a dual thromboxane synthase inhibitor and thromboxane A2 receptor antagonist, inhibits tumor necrosis factor-alpha biosynthesis. Eur J Pharmacol. 1995 Nov 3;286(1):31-9.
Ref 534187Structure-activity relationships of (E)-3-(1,4-benzoquinonyl)-2-[(3-pyridyl)-alkyl]-2-propenoic acid derivatives that inhibit both 5-lipoxygenase and thromboxane A2 synthetase. J Med Chem. 1996 Aug 2;39(16):3148-57.
Ref 534202Pharmacokinetic and pharmacodynamic properties of FK070 (KDI-792), a novel thromboxane receptor antagonist/thromboxane synthetase inhibitor, after single and multiple oral administrations to healthy volunteers. J Pharm Pharmacol. 1996 Apr;48(4):380-5.
Ref 534205Mechanisms of satigrel (E5510), a new anti-platelet drug, in inhibiting human platelet aggregation. Selectivity and potency against prostaglandin H synthases isozyme activities and phosphodiesterase isoform activities. Biol Pharm Bull. 1996 Jun;19(6):828-33.
Ref 534278Effects of the new class I antiarrhythmic agent Ro 22-9194, (2R)-2-amino-N-(2,6-dimethylphenyl)-N-[3-(3-pyridyl)propyl]propionamide D-tartrate, on ischemia- and reperfusion-induced arrhythmias in dogs: involvement of thromboxane A2 synthase inhibitory activity. J Pharmacol Exp Ther. 1996 Nov;279(2):877-83.
Ref 536325The novel phosphodiesterase inhibitor NM-702 improves claudication-limited exercise performance in patients with peripheral arterial disease. J Am Coll Cardiol. 2006 Dec 19;48(12):2539-45. Epub 2006Nov 28.
Ref 536468Nv-52: a novel thromboxane synthase inhibitor for the treatment of inflammatory bowel disease. Expert Opin Investig Drugs. 2007 Aug;16(8):1255-66.
Ref 536703Phase Ib single- and multiple-dose pharmacokinetic study of oral NV-52 in healthy volunteers. Drugs R D. 2008;9(3):159-66.
Ref 537655Involvement of thromboxane A2, leukotrienes and free radicals in puromycin nephrosis in rats. Kidney Int. 1991 May;39(5):920-9.
Ref 537729Metabolic protection of the reperfused canine endocardium by the thromboxane synthetase inhibitor, dazoxiben. Prostaglandins Leukot Essent Fatty Acids. 1988 Jul;33(1):13-22.
Ref 551276Pharmacological evaluation of combined PGI2 agonists/thromboxane synthase inhibitors, Bioorg. Med. Chem. Lett. 5(10):1087-1090 (1995).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.