Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16769
|
||||
Former ID |
TTDI02333
|
||||
Target Name |
X-linked inhibitor of apoptosis protein
|
||||
Gene Name |
XIAP
|
||||
Synonyms |
Baculoviral IAP repeatcontaining protein 4; E3 ubiquitinprotein ligase XIAP; IAP3; IAPlike protein; ILP; Inhibitor of apoptosis protein 3; Xlinked IAP; hIAP3; hILP; XIAP
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | ||||
Late-stage ovarian cancer; Lymphoma [ICD9:140-229, 183, 188, 202.8, 208.9; ICD10: C56, C67, C81-C86] | |||||
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
Obesity [ICD9: 278; ICD10: E66] | |||||
Function |
Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, copper homeostasis, mitogenic kinase signaling, cell proliferation, as well as cell invasion and metastasis. Acts as a direct caspase inhibitor. Directly bind to the active site pocket of CASP3 and CASP7 and obstructs substrate entry. Inactivates CASP9 by keeping it in a monomeric, inactive state. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and the target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, CASP3, CASP7, CASP8, CASP9, MAP3K2/MEKK2, DIABLO/SMAC, AIFM1, CCS and BIRC5/survivin. Ubiquitinion of CCS leads to enhancement of its chaperone activity toward its physiologic target, SOD1, rather than proteasomal degradation. Ubiquitinion ofMAP3K2/MEKK2 and AIFM1 does not lead to proteasomal degradation. Plays a role in copper homeostasis by ubiquitinationg COMMD1 and promoting its proteasomal degradation. Can also function as E3 ubiquitin-protein ligase of the NEDD8 conjugation pathway, targeting effector caspases for neddylation and inactivation. Regulates the BMP signaling pathway and the SMAD and MAP3K7/TAK1 dependent pathways leading to NF-kappa-B and JNK activation. Acts as an important regulator of innate immune signaling via regulation of Nodlike receptors (NLRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8. Acts as a positive regulator of Wnt signaling and ubiquitinates TLE1, TLE2, TLE3, TLE4 and AES. Ubiquitination of TLE3 results in inhibition of its interaction with TCF7L2/TCF4 thereby allowing efficient recruitment and binding of the transcriptional coactivator beta- catenin to TCF7L2/TCF4 that is required to initiate a Wnt-specific transcriptional program.
|
||||
BioChemical Class |
Carbon-nitrogen ligase
|
||||
UniProt ID | |||||
EC Number |
EC 6.3.2.-
|
||||
Sequence |
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK CPMCYTVITFKQKIFMS |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
KEGG Pathway | NF-kappa B signaling pathway | ||||
Ubiquitin mediated proteolysis | |||||
Apoptosis | |||||
Focal adhesion | |||||
Toxoplasmosis | |||||
HTLV-I infection | |||||
Pathways in cancer | |||||
Small cell lung cancer | |||||
PANTHER Pathway | Apoptosis signaling pathway | ||||
Pathway Interaction Database | p75(NTR)-mediated signaling | ||||
BMP receptor signaling | |||||
Caspase Cascade in Apoptosis | |||||
TGF-beta receptor signaling | |||||
Reactome | SMAC binds to IAPs | ||||
caspase complexes | |||||
Deactivation of the beta-catenin transactivating complex | |||||
RIPK1-mediated regulated necrosis | |||||
Regulation of TNFR1 signaling | |||||
TNFR1-induced NFkappaB signaling pathway | |||||
Regulation of necroptotic cell death | |||||
WikiPathways | Copper homeostasis | ||||
Focal Adhesion | |||||
Apoptosis | |||||
Intrinsic Pathway for Apoptosis | |||||
Apoptosis Modulation and Signaling | |||||
NOD pathway | |||||
References | |||||
Ref 521895 | ClinicalTrials.gov (NCT00382811) OVATURE (OVArian TUmor REsponse) A Phase III Study of Weekly Carboplatin With and Without Phenoxodiol in Patients With Platinum-Resistant, Recurrent Epithelial Ovarian Cancer. U.S. National Institutes of Health. | ||||
Ref 522367 | ClinicalTrials.gov (NCT00708006) A Study of HGS1029 (AEG40826-2HCl) in Subjects With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
Ref 524580 | ClinicalTrials.gov (NCT02022098) Debio 1143-201 Dose-finding and Efficacy Phase I/II Trial. U.S. National Institutes of Health. | ||||
Ref 524774 | ClinicalTrials.gov (NCT02147873) Study of Azacitidine With or Without Birinapant in Subjects With MDS or CMMoL. U.S. National Institutes of Health. | ||||
Ref 531843 | Discovery of a potent small-molecule antagonist of inhibitor of apoptosis (IAP) proteins and clinical candidate for the treatment of cancer (GDC-0152). J Med Chem. 2012 May 10;55(9):4101-13. | ||||
Ref 532662 | cIAPs and XIAP regulate myelopoiesis through cytokine production in an RIPK1- and RIPK3-dependent manner. Blood. 2014 Apr 17;123(16):2562-72. | ||||
Ref 532682 | Birinapant (TL32711), a bivalent SMAC mimetic, targets TRAF2-associated cIAPs, abrogates TNF-induced NF-?B activation, and is active in patient-derived xenograft models. Mol Cancer Ther. 2014 Apr;13(4):867-79. | ||||
Ref 533079 | Debio 1143, an antagonist of multiple inhibitor-of-apoptosis proteins, activates apoptosis and enhances radiosensitization of non-small cell lung cancer cells in vitro. Am J Cancer Res. 2014 Nov 19;4(6):943-51. eCollection 2014. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.