Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T98179
|
||||
| Former ID |
TTDR01018
|
||||
| Target Name |
Phosphopantetheine adenylyltransferase
|
||||
| Gene Name |
COASY
|
||||
| Synonyms |
Dephospho-CoA pyrophosphorylase; PPAT; Pantetheine-phosphate adenylyltransferase; COASY
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Function |
Bifunctional enzyme that catalyzes the fourth and fifth sequential steps of CoA biosynthetic pathway. The fourth reaction is catalyzed by the phosphopantetheine adenylyltransferase, coded by the coaD domain; the fifth reaction is catalyzed by the dephospho-CoA kinase, coded by the coaE domain. May act as a point of CoA biosynthesis regulation.
|
||||
| BioChemical Class |
Kinase
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.1.24
|
||||
| Sequence |
VAGSPKQPVRGYYRGAVGGTFDRLHNAHKVLLSVACILAQEQLVVGVADKDLLKSKLLPE
LLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDPSLEFLVVSEETYRGGMAIN RFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELPTCL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | PTX-007011 | Drug Info | Terminated | Bacterial infections | [1] |
| Inhibitor | 2-Methyl-2,4-Pentanediol | Drug Info | [2] | ||
| 4'-Phosphopantetheine | Drug Info | [2] | |||
| Adenosine-5'-Diphosphate | Drug Info | [3] | |||
| Coenzyme A | Drug Info | [2] | |||
| Dephospho Coenzyme A | Drug Info | [3] | |||
| PTX-007011 | Drug Info | [4] | |||
| Pathways | |||||
| KEGG Pathway | Pantothenate and CoA biosynthesis | ||||
| Metabolic pathways | |||||
| WikiPathways | Metabolism of water-soluble vitamins and cofactors | ||||
| References | |||||
| REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018127) | ||||
| REF 2 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 3 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
| REF 4 | NME DIGEST. Drug News & Perspect 2002, 15(8):519, ISSN 0214-0934. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.