Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T50444
|
||||
Former ID |
TTDC00213
|
||||
Target Name |
Connective tissue growth factor
|
||||
Gene Name |
CTGF
|
||||
Synonyms |
CCN2; Hypertrophic chondrocyte-specific protein 24; Long; CTGF
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Diabetic nephropathy [ICD9: 250.4; ICD10: E11.21] | ||||
Fibrosis [ICD9: 709.2; ICD10: L90.5] | |||||
Type 2 diabetes; Idiopathic pulmonary fibrosis [ICD9: 250, 250.00, 250.02, 515, 516.3, 709.2; ICD10: E08-E13, E11, J84.1, L90.5] | |||||
Function |
Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
|
||||
BioChemical Class |
CCN intercellular signaling protein
|
||||
Target Validation |
T50444
|
||||
UniProt ID | |||||
Sequence |
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Hippo signaling pathway | ||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
Pathway Interaction Database | amb2 Integrin signaling | ||||
TGF-beta receptor signaling | |||||
Reactome | PPARA activates gene expression | ||||
YAP1- and WWTR1 (TAZ)-stimulated gene expression | |||||
WikiPathways | Cytodifferentiation (Part 3 of 3) | ||||
Induction (Part 1 of 3) | |||||
Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
YAP1- and WWTR1 (TAZ)-stimulated gene expression | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.