Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T42928
|
||||
Former ID |
TTDI02071
|
||||
Target Name |
FGF-21 ligand
|
||||
Gene Name |
FGF21
|
||||
Synonyms |
Fibroblast growth factor 21; FGF21
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Type 2 diabetes [ICD9: 250; ICD10: E11] | ||||
Function |
Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB.
|
||||
BioChemical Class |
Growth factor
|
||||
UniProt ID | |||||
Sequence |
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGI LAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
Ras signaling pathway | |||||
Rap1 signaling pathway | |||||
PI3K-Akt signaling pathway | |||||
Regulation of actin cytoskeleton | |||||
Pathways in cancer | |||||
Melanoma | |||||
Reactome | Facilitative Na+-independent glucose transporters | ||||
Glucose transport | |||||
WikiPathways | Regulation of Actin Cytoskeleton | ||||
Aryl Hydrocarbon Receptor | |||||
SREBP signalling | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.