Target Information

Target General Infomation
Target ID
T02318
Former ID
TTDC00196
Target Name
Tumor necrosis factor ligand superfamily member 13B
Gene Name
TNFSF13B
Synonyms
B cell-activating factor; B lymphocyte stimulator; BAFF; BLyS; Dendritic cell-derived TNF-like molecule; TALL-1; TNF-and APOL-related leukocyte expressed ligand 1; UNQ401/PRO738; TNFSF13B
Target Type
Clinical Trial
Disease Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86]
Multiple myeloma [ICD9: 203; ICD10: C90]
Rheumatold arthritis; Idiopathic thrombocytopenic purpura [ICD9: 287.31, 710-719, 714; ICD10: D69.3, M00-M25, M05-M06]
Systemic lupus erythematosus [ICD9: 710; ICD10: M32]
Function
Isoform 3: Acts as a transcription factor for its own parent gene, in association with NF-kappa-B p50 subunit, at least in autoimmune and proliferative B-cell diseases. The presence of Delta4BAFF is essential for soluble BAFF release by IFNG/IFN- gamma-stimulated monocytes and for B-cell survival. It can directly or indirectly regulate the differential expression of a large number of genes involved in the innate immune response and the regulation of apoptosis.
BioChemical Class
Cytokine: tumor necrosis factor
Target Validation
T02318
UniProt ID
Q9Y275
Sequence
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCC
LTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
GEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEE
KENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETL
PNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Drugs and Mode of Action
Drug(s) Belimumab Drug Info Approved Systemic lupus erythematosus [537129], [541944]
Tabalumab Drug Info Phase 3 Multiple myeloma [532166], [542916]
BR3-Fc Drug Info Discontinued in Phase 2 Rheumatold arthritis; Idiopathic thrombocytopenic purpura [536737]
LymphoRad-131 Drug Info Discontinued in Phase 1 Lymphoma [547502]
Inhibitor 1,4-Diethylene Dioxide Drug Info [551391]
BR3-Fc Drug Info [536651], [536737]
Modulator LymphoRad-131 Drug Info [544263]
Tabalumab Drug Info [532166]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Intestinal immune network for IgA production
Rheumatoid arthritis
Reactome TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
WikiPathways Spinal Cord Injury
References
Ref 532166Tabalumab, an anti-BAFF monoclonal antibody, in patients with active rheumatoid arthritis with an inadequate response to TNF inhibitors. Ann Rheum Dis. 2013 Sep 1;72(9):1461-8.
Ref 536737Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54.
Ref 537129New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
Ref 541944(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6887).
Ref 542916(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8000).
Ref 547502Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016875)
Ref 532166Tabalumab, an anti-BAFF monoclonal antibody, in patients with active rheumatoid arthritis with an inadequate response to TNF inhibitors. Ann Rheum Dis. 2013 Sep 1;72(9):1461-8.
Ref 535687BAFF: B cell survival factor and emerging therapeutic target for autoimmune disorders. Expert Opin Ther Targets. 2003 Feb;7(1):115-23.
Ref 536651Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
Ref 536737Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54.
Ref 544263Fusion Toxin BLyS-Gelonin Inhibits Growth of Malignant Human B Cell Lines In Vitro and In Vivo. PLoS One. 2012; 7(10): e47361.
Ref 550963Clinical pipeline report, company report or official report of GlaxoSmithKline (2009).
Ref 551391DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.