Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T15344
|
||||
| Former ID |
TTDI02197
|
||||
| Target Name |
Activation-inducible TNFR family receptor
|
||||
| Gene Name |
TNFRSF18
|
||||
| Synonyms |
CD357; Glucocorticoid-induced TNFR-related protein; Tumor necrosis factor receptor superfamily member 18; TNFRSF18
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Melanoma [ICD9: 172; ICD10: C43] | ||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway.
|
||||
| BioChemical Class |
Cytokine receptor
|
||||
| UniProt ID | |||||
| Sequence |
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW V |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | MK-4166 | Drug Info | Phase 1 | Solid tumours | [1] |
| TRX-518 | Drug Info | Phase 1 | Melanoma | [2] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| Pathway Interaction Database | Downstream signaling in na& | ||||
| #xef | |||||
| ve CD8+ T cells | |||||
| Reactome | TNFs bind their physiological receptors | ||||
| References | |||||
| REF 1 | ClinicalTrials.gov (NCT02132754) Study of MK-4166 in Participants With Advanced Solid Tumors (MK-4166-001). U.S. National Institutes of Health. | ||||
| REF 2 | ClinicalTrials.gov (NCT01239134) Trial of TRX518 (Anti-GITR mAb) in Stage III or IV Malignant Melanoma or Other Solid Tumors. U.S. National Institutes of Health. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.