Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16128
|
||||
Former ID |
TTDI02076
|
||||
Target Name |
Gastrin
|
||||
Gene Name |
GAST
|
||||
Synonyms |
G14; G17; G34; G52; G6; Gastrin6; GAST
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Gastric cancer [ICD9: 151; ICD10: C16] | ||||
Function |
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
|
||||
BioChemical Class |
Gastrin cholecystokinin
|
||||
UniProt ID | |||||
Sequence |
MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN |
||||
Drugs and Mode of Action | |||||
Drug(s) | G17DT | Drug Info | Phase 3 | Gastric cancer | [1] |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Gastric acid secretion | ||||
PANTHER Pathway | CCKR signaling map ST | ||||
PathWhiz Pathway | Gastric Acid Production | ||||
Reactome | G alpha (q) signalling events | ||||
Gastrin-CREB signalling pathway via PKC and MAPK | |||||
WikiPathways | Gastrin-CREB signalling pathway via PKC and MAPK | ||||
Secretion of Hydrochloric Acid in Parietal Cells | |||||
Gastric acid production | |||||
GPCR downstream signaling | |||||
References | |||||
REF 1 | ClinicalTrials.gov (NCT02118077) Sequential Trial of G17DT for the Treatment of Advanced Pancreatic Cancer. U.S. National Institutes of Health. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.