Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T40010
|
||||
| Former ID |
TTDC00238
|
||||
| Target Name |
EGF-like domain-containing protein 7
|
||||
| Gene Name |
EGFL7
|
||||
| Synonyms |
Multiple EGF-like domain protein 7; Multiple epidermal growth factor-like domain protein 7; NOTCH4-like protein; VE-statin; Vascular endothelial statin; ZNEU1; EGFL7
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Non-small-cell lung cancer; Metastatic colorectal cancer [ICD9: 140-199, 140-229, 153, 154, 162, 204.0, 210-229; ICD10: C18-C21, C33, C33-C34, C34, C91.0, D10-D36, D3A] | ||||
| Function |
Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis.
|
||||
| BioChemical Class |
Growth factor
|
||||
| Target Validation |
T40010
|
||||
| UniProt ID | |||||
| Sequence |
MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | MEGF0444A | Drug Info | Phase 2 | Metastatic colorectal cancer; Non-small cell lung cancer | [1] |
| Anti-EGFL7 | Drug Info | Phase 1 | Non-small-cell lung cancer; Metastatic colorectal cancer | [2] | |
| RG7414 | Drug Info | Discontinued in Phase 2 | Non-small-cell lung cancer; Metastatic colorectal cancer | [3] | |
| Modulator | MEGF0444A | Drug Info | [4] | ||
| RG7414 | Drug Info | [5] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| References | |||||
| REF 1 | ClinicalTrials.gov (NCT00909740) A Study of the Safety and Pharmacokinetics of MEGF0444A Administered to Patients With Advanced Solid Tumors. U.S. National Institutes of Health. | ||||
| REF 2 | Clinical pipeline report, company report or official report of Genentech (2011). | ||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030998) | ||||
| REF 4 | A first-in-human phase Ia open-label dose-escalation study of the safety, pharmacokinetics (PK), and pharmacodynamics (PD) of the humanized monoclonal antibody (huMAb) anti-EGFL7 (MEGF0444A) administered intravenously in patients with advanced solid tumors. J Clin Oncol (Meeting Abstracts) May 2011 vol.29 no.15_suppl 2614. | ||||
| REF 5 | Anti-EGFL7 antibodies enhance stress-induced endothelial cell death and anti-VEGF efficacy. J Clin Invest. 2013 September 3; 123(9): 3997-4009. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.