Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T55860
|
||||
Former ID |
TTDI02194
|
||||
Target Name |
OX40 ligand
|
||||
Gene Name |
TNFSF4
|
||||
Synonyms |
CD252; Glycoprotein Gp34; OX40L; TAX transcriptionally-activated glycoprotein 1; Tumor necrosis factor ligand superfamily member 4; TNFSF4
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Asthma [ICD10: J45] | ||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
|
||||
BioChemical Class |
Cytokine: tumor necrosis factor
|
||||
UniProt ID | |||||
Sequence |
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQ
SIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQ KDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEF CVL |
||||
Drugs and Mode of Action | |||||
Modulator | R4930 | Drug Info | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
TSLP Signaling Pathway | |||||
Reactome | TNFs bind their physiological receptors | ||||
WikiPathways | Vitamin D Receptor Pathway | ||||
TSLP Signaling Pathway | |||||
References | |||||
Ref 525142 | ClinicalTrials.gov (NCT02410512) A Dose-Escalation Study of the Safety and Pharmacokinetics of MOXR0916 and MPDL3280A in Patients With Locally Advanced or Metastatic Solid Tumors. U.S. National Institutes of Health. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.