Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T83192
|
||||
| Former ID |
TTDR00032
|
||||
| Target Name |
Ciliary neurotrophic factor
|
||||
| Gene Name |
CNTF
|
||||
| Synonyms |
CNTF
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Huntington's disease [ICD9: 294.1, 333.4; ICD10: F02.2, G10] | ||||
| Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
| Function |
CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
|
||||
| BioChemical Class |
Ciliary neurotrophic factor
|
||||
| UniProt ID | |||||
| Sequence |
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS SHQTGIPARGSHYIANNKKM |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | CNTF, Syntex-Synergen, cell therapy | Drug Info | Phase 2 | Huntington's disease | [1] |
| NT-501 CNTF | Drug Info | Phase 1/2 | Ovarian cancer | [2] | |
| Modulator | CNTF, Syntex-Synergen, cell therapy | Drug Info | [3], [4] | ||
| NT-501 CNTF | Drug Info | [5] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
| Jak-STAT signaling pathway | |||||
| WikiPathways | Differentiation Pathway | ||||
| References | |||||
| REF 1 | ClinicalTrials.gov (NCT01530659) Retinal Imaging of Subjects Implanted With Ciliary Neurotrophic Factor (CNTF)-Releasing Encapsulated Cell Implant for Early-stage Retinitis Pigmentosa. U.S. National Institutes of Health. | ||||
| REF 2 | ClinicalTrials.gov (NCT01648452) CNTF Implants for CNGB3 Achromatopsia. U.S. National Institutes of Health. | ||||
| REF 3 | Protective effect of encapsulated cells producing neurotrophic factor CNTF in a monkey model of Huntington's disease. Nature. 1997 Mar 27;386(6623):395-9. | ||||
| REF 4 | Reliability of maximal voluntary isometric contraction testing in a multicenter study of patients with amyotrophic lateral sclerosis. Syntex/Synergen Neuroscience Joint Venture rhCNTF ALS Study Group. Muscle Nerve. 1997 Jun;20(6):691-5. | ||||
| REF 5 | Clinical pipeline report, company report or official report of Neurotech. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.