Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T86115
|
||||
Former ID |
TTDC00328
|
||||
Target Name |
mRNA of ApoC-III
|
||||
Gene Name |
APOC3
|
||||
Synonyms |
mRNA of Apo-CIII; mRNA of ApoC-III; mRNA of Apolipoprotein C3; APOC3
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Inflammation; High triglycerides; Atherosclerosis; Metabolic syndrome [ICD9: 277.7, 414.0, 440; ICD10: E88.81, I70] | ||||
Function |
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors.
|
||||
BioChemical Class |
Apolipoprotein
|
||||
UniProt ID | |||||
Sequence |
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
||||
Drugs and Mode of Action | |||||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.