Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T18639
|
||||
| Former ID |
TTDR00925
|
||||
| Target Name |
Heparin-binding growth factor1
|
||||
| Gene Name |
FGF1
|
||||
| Synonyms |
AFGF; Acidic fibroblast growth factor; Beta-endothelial cell growth factor; ECGF-beta; Fibroblast growth factor 1; HBGF-1; FGF1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Coronary artery disease [ICD9: 410-414, 429.2; ICD10: I20-I25] | ||||
| Critical limb ischemia [ICD9: 459.89; ICD10: I99.8] | |||||
| Function |
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
|
||||
| BioChemical Class |
Growth factor
|
||||
| UniProt ID | |||||
| Sequence |
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | CVBT-141H | Drug Info | Phase 2 | Coronary artery disease | [1] |
| Riferminogene pecaplasmid | Drug Info | Discontinued in Phase 3 | Critical limb ischemia | [2] | |
| Inhibitor | 5-AMINO-NAPHTALENE-2-MONOSULFONATE | Drug Info | [3] | ||
| Formic Acid | Drug Info | [4] | |||
| N,O6-Disulfo-Glucosamine | Drug Info | [4] | |||
| Naphthalene Trisulfonate | Drug Info | [4] | |||
| O2-Sulfo-Glucuronic Acid | Drug Info | [4] | |||
| Sucrose Octasulfate | Drug Info | [4] | |||
| Modulator | CVBT-141H | Drug Info | [5] | ||
| Riferminogene pecaplasmid | Drug Info | [6] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| Ras signaling pathway | |||||
| Rap1 signaling pathway | |||||
| PI3K-Akt signaling pathway | |||||
| Hippo signaling pathway | |||||
| Regulation of actin cytoskeleton | |||||
| Pathways in cancer | |||||
| Melanoma | |||||
| PANTHER Pathway | Angiogenesis | ||||
| FGF signaling pathway | |||||
| Pathway Interaction Database | FGF signaling pathway | ||||
| Reactome | PI3K Cascade | ||||
| PIP3 activates AKT signaling | |||||
| FGFR4 ligand binding and activation | |||||
| FGFR3c ligand binding and activation | |||||
| FGFR2c ligand binding and activation | |||||
| FGFR2b ligand binding and activation | |||||
| FGFR3 mutant receptor activation | |||||
| Activated point mutants of FGFR2 | |||||
| Constitutive Signaling by Aberrant PI3K in Cancer | |||||
| FGFR1 | |||||
| Phospholipase C-mediated cascade | |||||
| Phospholipase C-mediated cascade | |||||
| Phospholipase C-mediated cascade | |||||
| FGFR1 | |||||
| FGFR1 | |||||
| FRS-mediated FGFR1 signaling | |||||
| FGFR2 | |||||
| FGFR2 | |||||
| FRS-mediated FGFR2 signaling | |||||
| FGFR3 | |||||
| FRS-mediated FGFR3 signaling | |||||
| FGFR3 | |||||
| FRS-mediated FGFR4 signaling | |||||
| FGFR4 | |||||
| FGFR4 | |||||
| Negative regulation of FGFR1 signaling | |||||
| Negative regulation of FGFR2 signaling | |||||
| Negative regulation of FGFR3 signaling | |||||
| Negative regulation of FGFR4 signaling | |||||
| RAF/MAP kinase cascade | |||||
| WikiPathways | Regulation of Actin Cytoskeleton | ||||
| Differentiation Pathway | |||||
| Organogenesis (Part 2 of 3) | |||||
| Signaling by Type 1 Insulin-like Growth Factor 1 Receptor (IGF1R) | |||||
| PIP3 activates AKT signaling | |||||
| Integrated Pancreatic Cancer Pathway | |||||
| Signaling by FGFR | |||||
| References | |||||
| REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020529) | ||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011879) | ||||
| REF 3 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
| REF 4 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 5 | Clinical pipeline report, company report or official report of CVBT. | ||||
| REF 6 | Riferminogene pecaplasmide. Am J Cardiovasc Drugs. 2010;10(5):343-6. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.